{
    "uniprot_canonical_ac": "Q8BPB0-1",
    "uniprot_ac": "Q8BPB0",
    "uniprot_id": "MOB1B_MOUSE",
    "mass": {
        "chemical_mass": 25091.0,
        "monoisotopic_mass": 25091.0
    },
    "refseq": {
        "ac": "NP_081011",
        "name": "MOB kinase activator 1B",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
    },
    "gene_names": [
        {
            "name": "Mob1b",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q8BPB0",
            "id": "Q8BPB0"
        },
        {
            "name": "1110003E08Rik; B230364F10; Mobkl1a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011",
            "id": "NP_081011"
        },
        {
            "name": "Mob1b",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011",
            "id": "NP_081011"
        },
        {
            "name": "Mobkl1a",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q8BPB0",
            "id": "Q8BPB0"
        }
    ],
    "protein_names": [
        {
            "name": "MOB kinase activator 1B",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q8BPB0"
        },
        {
            "name": "MOB kinase activator 1B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011",
            "id": "NP_081011"
        },
        {
            "name": "Mob1 homolog 1A",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8BPB0"
        },
        {
            "name": "Mps one binder kinase activator-like 1A",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q8BPB0"
        },
        {
            "name": "mps one binder kinase activator-like 1A; mob1 homolog 1A; MOB1, Mps One Binder kinase activator-like 1A",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011",
            "id": "NP_081011"
        }
    ],
    "function": [
        {
            "annotation": "Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8BPB0",
                    "url": "https://www.uniprot.org/uniprot/Q8BPB0#function"
                }
            ]
        },
        {
            "annotation": "EGFR Regulates the Hippo pathway by promoting the tyrosine phosphorylation of MOB1. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                },
                {
                    "database": "PubMed",
                    "id": "34725466",
                    "url": "https://glygen.org/publication/PubMed/34725466"
                }
            ]
        },
        {
            "annotation": "MOB1A and MOB1B have overlapping functions in skin homeostasis, and exert their roles as tumor suppressors by regulating downstream elements of the Hippo pathway.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                },
                {
                    "database": "PubMed",
                    "id": "23143302",
                    "url": "https://glygen.org/publication/PubMed/23143302"
                }
            ]
        },
        {
            "annotation": "MOBKL1A/MOBKL1B phosphorylation, by MST1 and MST2, is sufficient to inhibit proliferation through actions at several points in the cell cycle.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                },
                {
                    "database": "PubMed",
                    "id": "18328708",
                    "url": "https://glygen.org/publication/PubMed/18328708"
                }
            ]
        },
        {
            "annotation": "Mst1/2-catalyzed MOBKL1A/B phosphorylation slows proliferation and is therefore a likely contributor to the anti-proliferative action of Mst1 in naive T cells",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                },
                {
                    "database": "PubMed",
                    "id": "19073936",
                    "url": "https://glygen.org/publication/PubMed/19073936"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8BPB0",
                    "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Mob1b",
            "url": "https://www.uniprot.org/uniprot/Q8BPB0",
            "locus": {
                "chromosome": "5",
                "start_pos": 88912079,
                "end_pos": 88868714,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000006262",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000006262"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000006262",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000006262",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "68473",
            "url": "https://www.ncbi.nlm.nih.gov/gene/68473",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR005301",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR005301",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036703",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036703",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:68473",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:68473",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1915723",
            "url": "http://www.informatics.jax.org/marker/MGI:1915723",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "VDNEQMF",
            "url": "https://omabrowser.org/oma/group/VDNEQMF/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5471991at2759",
            "url": "http://www.orthodb.org/?query=5471991at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR22599",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22599",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR22599:SF63",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22599:SF63",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5B5V",
            "url": "https://www.rcsb.org/structure/5B5V",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5B5W",
            "url": "https://www.rcsb.org/structure/5B5W",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "5B6B",
            "url": "https://www.rcsb.org/structure/5B6B",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF03637",
            "url": "http://pfam.xfam.org/family/PF03637",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q8BPB0",
            "url": "http://purl.obolibrary.org/obo/PR_Q8BPB0",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-2028269",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2028269",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_081011",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3UDM0",
            "url": "https://www.uniprot.org/uniprot/Q3UDM0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3UDM0-1",
            "url": "https://www.uniprot.org/uniprot/Q3UDM0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8BPB0",
            "url": "https://www.uniprot.org/uniprot/Q8BPB0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8BPB0-1",
            "url": "https://www.uniprot.org/uniprot/Q8BPB0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR",
        "length": 216,
        "header": "sp|Q8BPB0-1|MOB1B_MOUSE Isoform 1 of MOB kinase activator 1B  OS=Mus musculus OX=10090 GN=Mob1b PE=1 SV=3 CANONICAL=Q8BPB0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q3UDM0-1",
            "url": "",
            "sequence": {
                "sequence": "MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNNICFAAVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR",
                "length": 221,
                "header": "tr|Q3UDM0-1|MOB1B_MOUSE Computationally mapped isoform of MOB kinase activator 1B  OS=Mus musculus OX=10090 GN=Mob1b PE=1 SV=1 CANONICAL=Q8BPB0-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 88904028,
                "end_pos": 88868967,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000113229.8",
                        "url": "https://www.ensembl.org/id/ENSMUST00000113229.8"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000108855.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000108855.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q8BPB0-1",
            "url": "",
            "sequence": {
                "sequence": "MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR",
                "length": 216,
                "header": "sp|Q8BPB0-1|MOB1B_MOUSE Isoform 1 of MOB kinase activator 1B  OS=Mus musculus OX=10090 GN=Mob1b PE=1 SV=3 CANONICAL=Q8BPB0-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 88904028,
                "end_pos": 88868967,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000006424",
                        "url": "https://www.ensembl.org/id/ENSMUST00000006424"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000006424",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000006424"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 12,
            "end_pos": 12,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine; by STK4/MST1",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8BPB0",
                    "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                }
            ],
            "site_lbl": "Thr12"
        },
        {
            "start_pos": 35,
            "end_pos": 35,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine; by STK4/MST1",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q8BPB0",
                    "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                }
            ],
            "site_lbl": "Thr35"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "MOBKL1A/MOBKL1B phosphorylation by MST1 and MST2 inhibits cell proliferation.",
            "journal": "Current biology : CB",
            "date": "2008",
            "authors": "Praskova M, Xia F, Avruch J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18328708",
                    "url": "https://glygen.org/publication/PubMed/18328708"
                }
            ]
        },
        {
            "title": "The Nore1B/Mst1 complex restrains antigen receptor-induced proliferation of naive T cells.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2008",
            "authors": "Zhou D, Medoff BD, Chen L, Li L, Zhang XF, Praskova M, Liu M, Landry A, Blumberg RS, Boussiotis VA, Xavier R, Avruch J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19073936",
                    "url": "https://glygen.org/publication/PubMed/19073936"
                }
            ]
        },
        {
            "title": "Cancer susceptibility and embryonic lethality in Mob1a/1b double-mutant mice.",
            "journal": "The Journal of clinical investigation",
            "date": "2012",
            "authors": "Nishio M, Hamada K, Kawahara K, Sasaki M, Noguchi F, Chiba S, Mizuno K, Suzuki SO, Dong Y, Tokuda M, Morikawa T, Hikasa H, Eggenschwiler J, Yabuta N, Nojima H, Nakagawa K, Hata Y, Nishina H, Mimori K, Mori M, Sasaki T, Mak TW, Nakano T, Itami S, Suzuki A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23143302",
                    "url": "https://glygen.org/publication/PubMed/23143302"
                }
            ]
        },
        {
            "title": "EGFR Regulates the Hippo pathway by promoting the tyrosine phosphorylation of MOB1.",
            "journal": "Communications biology",
            "date": "2021",
            "authors": "Ando T, Arang N, Wang Z, Costea DE, Feng X, Goto Y, Izumi H, Gilardi M, Ando K, Gutkind JS",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_081011",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081011"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34725466",
                    "url": "https://glygen.org/publication/PubMed/34725466"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:68473",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:68473",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-2028269",
            "name": "Signaling by Hippo",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2028269",
            "resource": "Reactome",
            "description": "Signaling by Hippo"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q7L9L4-1",
            "protein_name": "MOB kinase activator 1B",
            "gene_name": "MOB1B",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR",
                "length": 216
            },
            "evidence": [
                {
                    "id": "45227043",
                    "url": "http://www.informatics.jax.org/homology/45227043",
                    "database": "MGI"
                },
                {
                    "id": "Q8BPB0",
                    "url": "https://omabrowser.org/oma/group/Q8BPB0/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q95RA8-1",
            "protein_name": "MOB kinase activator-like 1",
            "gene_name": "mats",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI",
                "length": 219
            },
            "evidence": [
                {
                    "id": "Q8BPB0",
                    "url": "https://omabrowser.org/oma/group/Q8BPB0/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "kinase activator activity",
                        "id": "GO:0019209",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019209",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein kinase activator activity",
                        "id": "GO:0030295",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030295",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "kinase binding",
                        "id": "GO:0019900",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "positive regulation of protein phosphorylation",
                        "id": "GO:0001934",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hippo signaling",
                        "id": "GO:0035329",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035329",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of protein autophosphorylation",
                        "id": "GO:0031952",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031952",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q8BPB0",
                                "url": "https://www.uniprot.org/uniprot/Q8BPB0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 180,
            "end_pos": 182,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}