{ "uniprot_canonical_ac": "Q8BI36-1", "uniprot_ac": "Q8BI36", "uniprot_id": "JKAMP_MOUSE", "mass": { "chemical_mass": 35248.0, "monoisotopic_mass": 35248.0 }, "refseq": { "ac": "NP_001191996", "name": "JNK1/MAPK8-associated membrane protein isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" }, "gene_names": [ { "name": "Jkamp", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BI36", "id": "Q8BI36" }, { "name": "1200003C05Rik; 2310047L11Rik; Jamp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996", "id": "NP_001191996" }, { "name": "Jamp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8BI36", "id": "Q8BI36" }, { "name": "Jkamp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996", "id": "NP_001191996" } ], "protein_names": [ { "name": "JNK1/MAPK8-associated membrane protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BI36" }, { "name": "JAMP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BI36" }, { "name": "JKAMP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BI36" }, { "name": "JNK1-associated membrane protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BI36" }, { "name": "JNK1/MAPK8-associated membrane protein isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996", "id": "NP_001191996" }, { "name": "Medulloblastoma antigen MU-MB-50.4 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BI36" }, { "name": "medulloblastoma antigen MU-MB-50.4 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996", "id": "NP_001191996" } ], "function": [ { "annotation": "C-Jun NH2 -Terminal Protein Kinase Phosphorylates the Nrf2-ECH Homology 6 Domain of Nuclear Factor Erythroid 2-Related Factor 2 and Downregulates Cytoprotective Genes in Acetaminophen-Induced Liver Injury in Mice.", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" }, { "database": "PubMed", "id": "31945188", "url": "https://glygen.org/publication/PubMed/31945188" } ] }, { "annotation": "JAMP is a membrane-anchored regulator of the duration of JNK1 activity in response to diverse stress stimuli [JAMP, a Jun N-terminal kinase 1 (JNK1)-associated membrane protein]", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" }, { "database": "PubMed", "id": "16166642", "url": "https://glygen.org/publication/PubMed/16166642" } ] }, { "annotation": "JAMP is an important component for coordinated clearance of misfolded proteins from the endoplasmic reticulum.", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" }, { "database": "PubMed", "id": "18784250", "url": "https://glygen.org/publication/PubMed/18784250" } ] }, { "annotation": "JKAMP inhibits the osteogenic capacity of adipose-derived stem cells in diabetic osteoporosis by modulating the Wnt signaling pathway through intragenic DNA methylation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" }, { "database": "PubMed", "id": "33579371", "url": "https://glygen.org/publication/PubMed/33579371" } ] }, { "annotation": "May be a regulator of the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) luminal proteins through the recruitment of components of the proteasome and endoplasmic reticulum-associated degradation (ERAD) system.", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36#function" }, { "database": "PubMed", "id": "16166642", "url": "https://glygen.org/publication/PubMed/16166642" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 24, "end_pos": 24, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" }, { "database": "PubMed", "id": "16166642", "url": "https://glygen.org/publication/PubMed/16166642" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Jkamp", "url": "https://www.uniprot.org/uniprot/Q8BI36", "locus": { "chromosome": "12", "start_pos": 72148235, "end_pos": 72132363, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000005078", "url": "https://www.ensembl.org/id/ENSMUSG00000005078" } ] } } ], "crossref": [ { "id": "ENSMUSG00000005078", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000005078", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "104771", "url": "https://www.ncbi.nlm.nih.gov/gene/104771", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008485", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008485", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:104771", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:104771", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1915057", "url": "http://www.informatics.jax.org/marker/MGI:1915057", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HWLLHGY", "url": "https://omabrowser.org/oma/group/HWLLHGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2912838at2759", "url": "http://www.orthodb.org/?query=2912838at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12740", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12740", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12740:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12740:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12740:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12740:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05571", "url": "http://pfam.xfam.org/family/PF05571", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BI36", "url": "http://purl.obolibrary.org/obo/PR_Q8BI36", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B8JJ81", "url": "https://www.uniprot.org/uniprot/B8JJ81", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8JJ81-1", "url": "https://www.uniprot.org/uniprot/B8JJ81-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BI36-1", "url": "https://www.uniprot.org/uniprot/Q8BI36-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BI36-2", "url": "https://www.uniprot.org/uniprot/Q8BI36-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH", "length": 311, "header": "sp|Q8BI36-1|JKAMP_MOUSE Isoform 1 of JNK1/MAPK8-associated membrane protein OS=Mus musculus OX=10090 GN=Jkamp PE=1 SV=2 CANONICAL=Q8BI36-1" }, "isoforms": [ { "isoform_ac": "B8JJ81-1", "url": "", "sequence": { "sequence": "MQAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLL", "length": 214, "header": "tr|B8JJ81-1|B8JJ81_MOUSE Computationally mapped isoform of JNK1/MAPK8-associated membrane protein OS=Mus musculus OX=10090 GN=Jkamp PE=4 SV=1 CANONICAL=Q8BI36-1" }, "locus": { "chromosome": "12", "start_pos": 72141640, "end_pos": 72132441, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000125764.8", "url": "https://www.ensembl.org/id/ENSMUST00000125764.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000117251.2", "url": "https://www.ensembl.org/id/ENSMUSP00000117251.2" } ] } }, { "isoform_ac": "Q8BI36-1", "url": "", "sequence": { "sequence": "MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH", "length": 311, "header": "sp|Q8BI36-1|JKAMP_MOUSE Isoform 1 of JNK1/MAPK8-associated membrane protein OS=Mus musculus OX=10090 GN=Jkamp PE=1 SV=2 CANONICAL=Q8BI36-1" }, "locus": { "chromosome": "12", "start_pos": 72147599, "end_pos": 72132954, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000057257", "url": "https://www.ensembl.org/id/ENSMUST00000057257" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000061370", "url": "https://www.ensembl.org/id/ENSMUSP00000061370" } ] } }, { "isoform_ac": "Q8BI36-2", "url": "", "sequence": { "sequence": "MACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH", "length": 305, "header": "sp|Q8BI36-2|JKAMP_MOUSE Isoform 2 of JNK1/MAPK8-associated membrane protein OS=Mus musculus OX=10090 GN=Jkamp PE=1 SV=2 CANONICAL=Q8BI36-1" }, "locus": { "chromosome": "12", "start_pos": 72147599, "end_pos": 72132954, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000117449", "url": "https://www.ensembl.org/id/ENSMUST00000117449" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113744", "url": "https://www.ensembl.org/id/ENSMUSP00000113744" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 22, "start_aa": "Asn", "end_pos": 22, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn22", "evidence": [ { "id": "Q8BI36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BI36#ptm_processing" }, { "id": "16166642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16166642" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "JAMP, a Jun N-terminal kinase 1 (JNK1)-associated membrane protein, regulates duration of JNK activity.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Kadoya T, Khurana A, Tcherpakov M, Bromberg KD, Didier C, Broday L, Asahara T, Bhoumik A, Ronai Z", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36#ptm_processing" }, { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" }, { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" } ], "reference": [ { "type": "PubMed", "id": "16166642", "url": "https://glygen.org/publication/PubMed/16166642" } ] }, { "title": "JAMP optimizes ERAD to protect cells from unfolded proteins.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Tcherpakov M, Broday L, Delaunay A, Kadoya T, Khurana A, Erdjument-Bromage H, Tempst P, Qiu XB, DeMartino GN, Ronai Z", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" }, { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" } ], "reference": [ { "type": "PubMed", "id": "18784250", "url": "https://glygen.org/publication/PubMed/18784250" } ] }, { "title": "Regulation of endoplasmic reticulum-associated degradation by RNF5-dependent ubiquitination of JNK-associated membrane protein (JAMP).", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Tcherpakov M, Delaunay A, Toth J, Kadoya T, Petroski MD, Ronai ZA", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "reference": [ { "type": "PubMed", "id": "19269966", "url": "https://glygen.org/publication/PubMed/19269966" } ] }, { "title": "c-Jun NH2 -Terminal Protein Kinase Phosphorylates the Nrf2-ECH Homology 6 Domain of Nuclear Factor Erythroid 2-Related Factor 2 and Downregulates Cytoprotective Genes in Acetaminophen-Induced Liver Injury in Mice.", "journal": "Hepatology (Baltimore, Md.)", "date": "2020", "authors": "Chen Y, Liu K, Zhang J, Hai Y, Wang P, Wang H, Liu Q, Wong CCL, Yao J, Gao Y, Liao Y, Tang X, Wang XJ", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" } ], "reference": [ { "type": "PubMed", "id": "31945188", "url": "https://glygen.org/publication/PubMed/31945188" } ] }, { "title": "JKAMP inhibits the osteogenic capacity of adipose-derived stem cells in diabetic osteoporosis by modulating the Wnt signaling pathway through intragenic DNA methylation.", "journal": "Stem cell research & therapy", "date": "2021", "authors": "Peng S, Shi S, Tao G, Li Y, Xiao D, Wang L, He Q, Cai X, Xiao J", "evidence": [ { "database": "RefSeq", "id": "NP_001191996", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191996" } ], "reference": [ { "type": "PubMed", "id": "33579371", "url": "https://glygen.org/publication/PubMed/33579371" } ] } ], "pathway": [ { "id": "mmu:104771", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:104771", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZZT8-1", "protein_name": "JNK1/MAPK8-associated membrane protein", "gene_name": "Jkamp", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH", "length": 311 }, "evidence": [ { "id": "45232907", "url": "http://www.informatics.jax.org/homology/45232907", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9P055-4", "protein_name": "JNK1/MAPK8-associated membrane protein", "gene_name": "JKAMP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH", "length": 311 }, "evidence": [ { "id": "Q8BI36", "url": "https://omabrowser.org/oma/group/Q8BI36/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to unfolded protein", "id": "GO:0006986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006986", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "pmid": "" }, { "name": "ubiquitin-dependent ERAD pathway", "id": "GO:0030433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030433", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 22, "end_pos": 24, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated by RNF5 via 'Lys-63'-linked ubiquitin linkage in a UBE2N-dependent manner. Ubiquitination decreases association with components of the proteasome and ERAD.", "evidence": [ { "database": "UniProtKB", "id": "Q8BI36", "url": "https://www.uniprot.org/uniprot/Q8BI36" }, { "database": "PubMed", "id": "19269966", "url": "https://glygen.org/publication/PubMed/19269966" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }