{ "uniprot_canonical_ac": "Q8BGH7-1", "uniprot_ac": "Q8BGH7", "uniprot_id": "C42S2_MOUSE", "mass": { "chemical_mass": 9223.0, "monoisotopic_mass": 9223.0 }, "refseq": { "ac": "NP_848741", "name": "CDC42 small effector protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848741" }, "gene_names": [ { "name": "Cdc42se2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BGH7", "id": "Q8BGH7" }, { "name": "2810404F18Rik; SPEC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848741", "id": "NP_848741" }, { "name": "Cdc42se2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848741", "id": "NP_848741" } ], "protein_names": [ { "name": "CDC42 small effector protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BGH7" }, { "name": "CDC42 small effector protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848741", "id": "NP_848741" } ], "function": [ { "annotation": "Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7#function" }, { "database": "UniProtKB", "id": "B1AZK1", "url": "https://www.uniprot.org/uniprot/B1AZK1#function" }, { "database": "UniProtKB", "id": "ARBA00025235", "url": "https://www.uniprot.org/uniprot/ARBA00025235#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cdc42se2", "url": "https://www.uniprot.org/uniprot/Q8BGH7", "locus": { "chromosome": "11", "start_pos": 54608282, "end_pos": 54678501, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000052298", "url": "https://www.ensembl.org/id/ENSMUSG00000052298" } ] } } ], "crossref": [ { "id": "ENSMUSG00000052298", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000052298", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00132", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00132", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "72729", "url": "https://www.ncbi.nlm.nih.gov/gene/72729", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000095", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000095", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:72729", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72729", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1919979", "url": "http://www.informatics.jax.org/marker/MGI:1919979", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q8BGH7", "url": "https://oglcnac.org/atlas/detail/Q8BGH7", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q8BGH7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8BGH7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IGVPTNF", "url": "https://omabrowser.org/oma/group/IGVPTNF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2787572at2759", "url": "http://www.orthodb.org/?query=2787572at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13502", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13502", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13502:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13502:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00786", "url": "http://pfam.xfam.org/family/PF00786", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BGH7", "url": "http://purl.obolibrary.org/obo/PR_Q8BGH7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_848741", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848741", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B1AZK1", "url": "https://www.uniprot.org/uniprot/B1AZK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AZK1-1", "url": "https://www.uniprot.org/uniprot/B1AZK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BGH7-1", "url": "https://www.uniprot.org/uniprot/Q8BGH7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG", "length": 84, "header": "sp|Q8BGH7-1|C42S2_MOUSE Isoform 1 of CDC42 small effector protein 2 OS=Mus musculus OX=10090 GN=Cdc42se2 PE=1 SV=1 CANONICAL=Q8BGH7-1" }, "isoforms": [ { "isoform_ac": "B1AZK1-1", "url": "", "sequence": { "sequence": "MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNS", "length": 52, "header": "tr|B1AZK1-1|B1AZK1_MOUSE Computationally mapped isoform of CDC42 small effector 2 OS=Mus musculus OX=10090 GN=Cdc42se2 PE=3 SV=1 CANONICAL=Q8BGH7-1" }, "locus": { "chromosome": "11", "start_pos": 54631117, "end_pos": 54614400, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000153209.8", "url": "https://www.ensembl.org/id/ENSMUST00000153209.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120253.2", "url": "https://www.ensembl.org/id/ENSMUSP00000120253.2" } ] } }, { "isoform_ac": "Q8BGH7-1", "url": "", "sequence": { "sequence": "MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG", "length": 84, "header": "sp|Q8BGH7-1|C42S2_MOUSE Isoform 1 of CDC42 small effector protein 2 OS=Mus musculus OX=10090 GN=Cdc42se2 PE=1 SV=1 CANONICAL=Q8BGH7-1" }, "locus": { "chromosome": "11", "start_pos": 54631117, "end_pos": 54611088, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000064104", "url": "https://www.ensembl.org/id/ENSMUST00000064104" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000070725", "url": "https://www.ensembl.org/id/ENSMUSP00000070725" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 81, "start_aa": "Thr", "end_pos": 81, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr81", "evidence": [ { "id": "Q8BGH7", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q8BGH7" }, { "id": "34678516", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34678516" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q8BGH7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8BGH7" }, { "id": "34678516", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34678516" } ] } ], "phosphorylation": [ { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8BGH7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8BGH7" } ], "site_lbl": "Ser43" }, { "start_pos": 52, "end_pos": 52, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q8BGH7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8BGH7" } ], "site_lbl": "Ser52" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The role of SPECs, small Cdc42-binding proteins, in F-actin accumulation at the immunological synapse.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Ching KH, Kisailus AE, Burbelo PD", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "reference": [ { "type": "PubMed", "id": "15840583", "url": "https://glygen.org/publication/PubMed/15840583" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" }, { "database": "iPTMnet", "id": "Q8BGH7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8BGH7" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Novel Antibodies for the Simple and Efficient Enrichment of Native O-GlcNAc Modified Peptides.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Burt RA, Dejanovic B, Peckham HJ, Lee KA, Li X, Ounadjela JR, Rao A, Malaker SA, Carr SA, Myers SA", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q8BGH7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8BGH7" }, { "database": "O-GlcNAc Atlas", "id": "Q8BGH7", "url": "https://oglcnac.org/atlas/detail/Q8BGH7" } ], "reference": [ { "type": "PubMed", "id": "34678516", "url": "https://glygen.org/publication/PubMed/34678516" } ] } ], "pathway": [ { "id": "mmu:72729", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72729", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A1L1K4-1", "protein_name": "CDC42 small effector protein 2", "gene_name": "Cdc42se2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSEFWLCFNCCIAEQPQPRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG", "length": 83 }, "evidence": [ { "id": "45240178", "url": "http://www.informatics.jax.org/homology/45240178", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NRR3-1", "protein_name": "CDC42 small effector protein 2", "gene_name": "CDC42SE2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG", "length": 84 }, "evidence": [ { "id": "45240178", "url": "http://www.informatics.jax.org/homology/45240178", "database": "MGI" }, { "id": "Q8BGH7", "url": "https://omabrowser.org/oma/group/Q8BGH7/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VNE7-1", "protein_name": "CDC42 small effector protein homolog", "gene_name": "Spec2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MASTGEIWLQWFSCCFQQQRSPSRRPHQRLRIDRSMIGNPTNFVHTGHIGSADVELSANRLNAISTQMQSKGGYETNSIHSLHAC", "length": 85 }, "evidence": [ { "id": "Q8BGH7", "url": "https://omabrowser.org/oma/group/Q8BGH7/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "phagocytic cup", "id": "GO:0001891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001891", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "regulation of Rho protein signal transduction", "id": "GO:0035023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035023", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "regulation of signal transduction", "id": "GO:0009966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009966", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" }, { "name": "signaling adaptor activity", "id": "GO:0035591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035591", "evidence": [ { "database": "UniProtKB", "id": "Q8BGH7", "url": "https://www.uniprot.org/uniprot/Q8BGH7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }