{ "uniprot_canonical_ac": "Q8BGD7-1", "uniprot_ac": "Q8BGD7", "uniprot_id": "NPAS4_MOUSE", "mass": { "chemical_mass": 87286.0, "monoisotopic_mass": 87286.0 }, "refseq": { "ac": "NP_705781", "name": "neuronal PAS domain-containing protein 4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, "gene_names": [ { "name": "Npas4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BGD7", "id": "Q8BGD7" }, { "name": "LE-PAS; Nxf", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781", "id": "NP_705781" }, { "name": "Npas4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781", "id": "NP_705781" }, { "name": "Nxf", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q8BGD7", "id": "Q8BGD7" } ], "protein_names": [ { "name": "Neuronal PAS domain-containing protein 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BGD7" }, { "name": "HLH-PAS transcription factor NXF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BGD7" }, { "name": "LE-PAS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BGD7" }, { "name": "Limbic-enhanced PAS protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BGD7" }, { "name": "Neuronal PAS4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BGD7" }, { "name": "bHLH-PAS type transcription factor NXF; limbic-enhanced PAS protein; neuronal PAS4; HLH-PAS transcription factor NXF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781", "id": "NP_705781" }, { "name": "neuronal PAS domain-containing protein 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781", "id": "NP_705781" } ], "function": [ { "annotation": "Dysregulation of Npas4 and Inhba expression and an altered excitation-inhibition balance are associated with cognitive deficits in DBA/2 mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "35042829", "url": "https://glygen.org/publication/PubMed/35042829" } ] }, { "annotation": "Functionally distinct NPAS4-expressing somatostatin interneuron ensembles critical for motor skill learning.", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "36099920", "url": "https://glygen.org/publication/PubMed/36099920" } ] }, { "annotation": "Identification of transcription factor Npas4, that plays a role in the development of inhibitory synapses by regulating the expression of activity-dependent genes, which in turn control the number of GABA-releasing synapses that form on excitatory neurons", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "18815592", "url": "https://glygen.org/publication/PubMed/18815592" } ] }, { "annotation": "MRNA expression in the hippocampus 1 h following generalized convulsive seizure, in a pattern which is typical for other activity-dependant genes expressed in this structure.", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "15380003", "url": "https://glygen.org/publication/PubMed/15380003" } ] }, { "annotation": "NPAS4 Exacerbates Pyroptosis via Transcriptionally Regulating NLRP6 in the Acute Phase of Intracerebral Hemorrhage in Mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "37176030", "url": "https://glygen.org/publication/PubMed/37176030" } ] }, { "annotation": "NPAS4 in the medial prefrontal cortex mediates chronic social defeat stress-induced anhedonia-like behavior and reductions in excitatory synapses. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" }, { "database": "PubMed", "id": "36780219", "url": "https://glygen.org/publication/PubMed/36780219" } ] }, { "annotation": "Transcription factor expressed in neurons of the brain that regulates the excitatory-inhibitory balance within neural circuits and is required for contextual memory in the hippocampus (PubMed:18815592, PubMed:22194569, PubMed:23029555, PubMed:24201284, PubMed:24855953). Plays a key role in the structural and functional plasticity of neurons (PubMed:23172225). Acts as an early-response transcription factor in both excitatory and inhibitory neurons, where it induces distinct but overlapping sets of late-response genes in these two types of neurons, allowing the synapses that form on inhibitory and excitatory neurons to be modified by neuronal activity in a manner specific to their function within a circuit, thereby facilitating appropriate circuit responses to sensory experience (PubMed:24201284, PubMed:24855953). In excitatory neurons, activates transcription of BDNF, which in turn controls the number of GABA-releasing synapses that form on excitatory neurons, thereby promoting an increased number of inhibitory synapses on excitatory neurons (PubMed:18815592, PubMed:22194569, PubMed:24201284). In inhibitory neurons, regulates a distinct set of target genes that serve to increase excitatory input onto somatostatin neurons, probably resulting in enhanced feedback inhibition within cortical circuits (PubMed:24855953). The excitatory and inhibitory balance in neurons affects a number of processes, such as short-term and long-term memory, acquisition of experience, fear memory, response to stress and social behavior (PubMed:18815592, PubMed:22194569, PubMed:23029555, PubMed:24201284, PubMed:27238022). Acts as a regulator of dendritic spine development in olfactory bulb granule cells in a sensory-experience-dependent manner by regulating expression of MDM2 (PubMed:25088421). Efficient DNA binding requires dimerization with another bHLH protein, such as ARNT, ARNT2 or BMAL1 (PubMed:14701734, PubMed:15363889, PubMed:19284974). Can activate the CME (CNS midline enhancer) element (PubMed:14701734, PubMed:15363889).", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7#function" }, { "database": "PubMed", "id": "18815592", "url": "https://glygen.org/publication/PubMed/18815592" }, { "database": "PubMed", "id": "25088421", "url": "https://glygen.org/publication/PubMed/25088421" }, { "database": "PubMed", "id": "24201284", "url": "https://glygen.org/publication/PubMed/24201284" }, { "database": "PubMed", "id": "23029555", "url": "https://glygen.org/publication/PubMed/23029555" }, { "database": "PubMed", "id": "22194569", "url": "https://glygen.org/publication/PubMed/22194569" }, { "database": "PubMed", "id": "27238022", "url": "https://glygen.org/publication/PubMed/27238022" }, { "database": "PubMed", "id": "15363889", "url": "https://glygen.org/publication/PubMed/15363889" }, { "database": "PubMed", "id": "24855953", "url": "https://glygen.org/publication/PubMed/24855953" }, { "database": "PubMed", "id": "14701734", "url": "https://glygen.org/publication/PubMed/14701734" }, { "database": "PubMed", "id": "23172225", "url": "https://glygen.org/publication/PubMed/23172225" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Npas4", "url": "https://www.uniprot.org/uniprot/Q8BGD7", "locus": { "chromosome": "19", "start_pos": 5034383, "end_pos": 5040344, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000045903", "url": "https://www.ensembl.org/id/ENSMUSG00000045903" } ] } } ], "crossref": [ { "id": "ENSMUSG00000045903", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000045903", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00130", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00130", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd19697", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19697", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "225872", "url": "https://www.ncbi.nlm.nih.gov/gene/225872", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013655", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013655", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:225872", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:225872", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2664186", "url": "http://www.informatics.jax.org/marker/MGI:2664186", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KTYFTQE", "url": "https://omabrowser.org/oma/group/KTYFTQE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "614770at2759", "url": "http://www.orthodb.org/?query=614770at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23043:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23043:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7XHV", "url": "https://www.rcsb.org/structure/7XHV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08447", "url": "http://pfam.xfam.org/family/PF08447", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BGD7", "url": "http://purl.obolibrary.org/obo/PR_Q8BGD7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9768919", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A494BA76", "url": "https://www.uniprot.org/uniprot/A0A494BA76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BA76-1", "url": "https://www.uniprot.org/uniprot/A0A494BA76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BGD7-1", "url": "https://www.uniprot.org/uniprot/Q8BGD7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSSGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDVSESVLIYLGFERSELLCKSWYGLLHPEDLAQASSQHYRLLAESGDIQAEMVVRLQAKHGGWTWIYCMLYSEGPEGPFTANNYPISDTEAWSLRQQLNSEDTQAAYVLGTPAVLPSFSENVFSQEQCSNPLFTPSLGTPRSASFPRAPELGVISTPEELPQPSKELDFSYLPFPARPEPSLQADLSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDPLTSSLQGQLTESSARSFEDQLTPCTSSFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGVDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF", "length": 802, "header": "sp|Q8BGD7-1|NPAS4_MOUSE Isoform 1 of Neuronal PAS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Npas4 PE=1 SV=1 CANONICAL=Q8BGD7-1" }, "isoforms": [ { "isoform_ac": "A0A494BA76-1", "url": "", "sequence": { "sequence": "MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSSGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDVSESG", "length": 236, "header": "tr|A0A494BA76-1|NPAS4_MOUSE Computationally mapped isoform of Neuronal PAS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Npas4 PE=1 SV=1 CANONICAL=Q8BGD7-1" }, "locus": { "chromosome": "19", "start_pos": 5039844, "end_pos": 5037475, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000237881.2", "url": "https://www.ensembl.org/id/ENSMUST00000237881.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000157974.2", "url": "https://www.ensembl.org/id/ENSMUSP00000157974.2" } ] } }, { "isoform_ac": "Q8BGD7-1", "url": "", "sequence": { "sequence": "MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSSGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDVSESVLIYLGFERSELLCKSWYGLLHPEDLAQASSQHYRLLAESGDIQAEMVVRLQAKHGGWTWIYCMLYSEGPEGPFTANNYPISDTEAWSLRQQLNSEDTQAAYVLGTPAVLPSFSENVFSQEQCSNPLFTPSLGTPRSASFPRAPELGVISTPEELPQPSKELDFSYLPFPARPEPSLQADLSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDPLTSSLQGQLTESSARSFEDQLTPCTSSFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGVDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF", "length": 802, "header": "sp|Q8BGD7-1|NPAS4_MOUSE Isoform 1 of Neuronal PAS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Npas4 PE=1 SV=1 CANONICAL=Q8BGD7-1" }, "locus": { "chromosome": "19", "start_pos": 5039844, "end_pos": 5035099, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000056129", "url": "https://www.ensembl.org/id/ENSMUST00000056129" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000062992", "url": "https://www.ensembl.org/id/ENSMUSP00000062992" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Ooe N, Saito K, Mikami N, Nakatuka I, Kaneko H", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "14701734", "url": "https://glygen.org/publication/PubMed/14701734" } ] }, { "title": "LE-PAS, a novel Arnt-dependent HLH-PAS protein, is expressed in limbic tissues and transactivates the CNS midline enhancer element.", "journal": "Brain Res. Mol. Brain Res.", "date": "2004", "authors": "Moser M., Patterson C., Bode C., Knoth R.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "15363889", "url": "https://glygen.org/publication/PubMed/15363889" } ] }, { "title": "Nxf and Fbxo33: novel seizure-responsive genes in mice.", "journal": "The European journal of neuroscience", "date": "2004", "authors": "Flood WD, Moyer RW, Tsykin A, Sutherland GR, Koblar SA", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "15380003", "url": "https://glygen.org/publication/PubMed/15380003" } ] }, { "title": "Activity-dependent regulation of inhibitory synapse development by Npas4.", "journal": "Nature", "date": "2008", "authors": "Lin Y, Bloodgood BL, Hauser JL, Lapan AD, Koon AC, Kim TK, Hu LS, Malik AN, Greenberg ME", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" }, { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "18815592", "url": "https://glygen.org/publication/PubMed/18815592" } ] }, { "title": "Functional characterization of basic helix-loop-helix-PAS type transcription factor NXF in vivo: putative involvement in an 'on demand' neuroprotection system.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Ooe N, Motonaga K, Kobayashi K, Saito K, Kaneko H", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "19001414", "url": "https://glygen.org/publication/PubMed/19001414" } ] }, { "title": "Characterization of functional heterodimer partners in brain for a bHLH-PAS factor NXF.", "journal": "Biochim. Biophys. Acta", "date": "2009", "authors": "Saito K., Kaneko H., Ooe N.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "19284974", "url": "https://glygen.org/publication/PubMed/19284974" } ] }, { "title": "Npas4 regulates a transcriptional program in CA3 required for contextual memory formation.", "journal": "Science", "date": "2011", "authors": "Ramamoorthi K, Fropf R, Belfort GM, Fitzmaurice HL, McKinney RM, Neve RL, Otto T, Lin Y", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "22194569", "url": "https://glygen.org/publication/PubMed/22194569" } ] }, { "title": "Npas4: a neuronal transcription factor with a key role in social and cognitive functions relevant to developmental disorders.", "journal": "PLoS ONE", "date": "2012", "authors": "Ardestani P.M., Beraki S., Coutellier L., Saw N.L., Shamloo M.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "23029555", "url": "https://glygen.org/publication/PubMed/23029555" } ] }, { "title": "Neuronal Per Arnt Sim (PAS) domain protein 4 (NPAS4) regulates neurite outgrowth and phosphorylation of synapsin I.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Yun J, Nagai T, Furukawa-Hibi Y, Kuroda K, Kaibuchi K, Greenberg ME, Yamada K", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "23172225", "url": "https://glygen.org/publication/PubMed/23172225" } ] }, { "title": "The activity-dependent transcription factor NPAS4 regulates domain-specific inhibition.", "journal": "Nature", "date": "2013", "authors": "Sharma N., Greenberg M.E., Bloodgood B.L., Browne H.A., Trepman A.Z.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "24201284", "url": "https://glygen.org/publication/PubMed/24201284" } ] }, { "title": "Regulation of the neuronal transcription factor NPAS4 by REST and microRNAs.", "journal": "Biochim. Biophys. Acta", "date": "2014", "authors": "Bersten DC, Wright JA, McCarthy PJ, Whitelaw ML", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "24291638", "url": "https://glygen.org/publication/PubMed/24291638" } ] }, { "title": "Npas4 regulates excitatory-inhibitory balance within neural circuits through cell-type-specific gene programs.", "journal": "Cell", "date": "2014", "authors": "Greenberg M.E., Tzeng C.P., Spiegel I., Harmin D.A., Mardinly A.R., Bazinet J.E., Couch C.H., Gabel H.W.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "24855953", "url": "https://glygen.org/publication/PubMed/24855953" } ] }, { "title": "Npas4 regulates Mdm2 and thus Dcx in experience-dependent dendritic spine development of newborn olfactory bulb interneurons.", "journal": "Cell Rep.", "date": "2014", "authors": "Yoshihara S, Takahashi H, Nishimura N, Kinoshita M, Asahina R, Kitsuki M, Tatsumi K, Furukawa-Hibi Y, Hirai H, Nagai T, Yamada K, Tsuboi A", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "25088421", "url": "https://glygen.org/publication/PubMed/25088421" } ] }, { "title": "Effects of Npas4 deficiency on anxiety, depression-like, cognition and sociability behaviour.", "journal": "Behav. Brain Res.", "date": "2015", "authors": "Lewis M.D., Baune B.T., Jaehne E.J., Klaric T.S., Koblar S.A.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "25549857", "url": "https://glygen.org/publication/PubMed/25549857" } ] }, { "title": "Npas4 deficiency increases vulnerability to juvenile stress in mice.", "journal": "Behav. Brain Res.", "date": "2015", "authors": "Coutellier L., Gilbert V., Shepard R.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "25911220", "url": "https://glygen.org/publication/PubMed/25911220" } ] }, { "title": "Npas4 transcription factor expression is regulated by calcium signaling pathways and prevents tacrolimus-induced cytotoxicity in pancreatic beta cells.", "journal": "J. Biol. Chem.", "date": "2016", "authors": "Speckmann T, Sabatini PV, Nian C, Smith RG, Lynn FC", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "26663079", "url": "https://glygen.org/publication/PubMed/26663079" } ] }, { "title": "miR-744 and miR-224 downregulate Npas4 and affect lineage differentiation potential and neurite development during neural differentiation of mouse embryonic stem cells.", "journal": "Mol. Neurobiol.", "date": "2017", "authors": "Lewis M.D., Choy F.C., Klaric T.S., Koblar S.A.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "27189618", "url": "https://glygen.org/publication/PubMed/27189618" } ] }, { "title": "Wiring and molecular features of prefrontal ensembles representing distinct experiences.", "journal": "Cell", "date": "2016", "authors": "Luo L., Ye L., Tian Q., Deisseroth K., Adhikari A., Allen W.E., Barth A.L., Halpern C.H., Hsueh B., Jennings J.H., McNab J.A., Ramakrishnan C., Thompson K.R., Wang A.C., Witten I.B.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "reference": [ { "type": "PubMed", "id": "27238022", "url": "https://glygen.org/publication/PubMed/27238022" } ] }, { "title": "Dysregulation of Npas4 and Inhba expression and an altered excitation-inhibition balance are associated with cognitive deficits in DBA/2 mice.", "journal": "Learning & memory (Cold Spring Harbor, N.Y.)", "date": "2022", "authors": "Oberlander K, Witte V, Mallien AS, Gass P, Bengtson CP, Bading H", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "35042829", "url": "https://glygen.org/publication/PubMed/35042829" } ] }, { "title": "Functionally distinct NPAS4-expressing somatostatin interneuron ensembles critical for motor skill learning.", "journal": "Neuron", "date": "2022-10-19", "authors": "Yang Jungwoo, Serrano Pablo, Yin Xuming, Sun Xiaochen, Lin Yingxi, Chen Simon X", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "36099920", "url": "https://glygen.org/publication/PubMed/36099920" } ] }, { "title": "NPAS4 in the medial prefrontal cortex mediates chronic social defeat stress-induced anhedonia-like behavior and reductions in excitatory synapses.", "journal": "eLife", "date": "2023-02-13", "authors": "Hughes Brandon W, Siemsen Benjamin M, Tsvetkov Evgeny, Berto Stefano, Kumar Jaswinder, Cornbrooks Rebecca G, Akiki Rose Marie, Cho Jennifer Y, Carter Jordan S, Snyder Kirsten K, Assali Ahlem, Scofield Michael D, Cowan Christopher W, Taniguchi Makoto", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "36780219", "url": "https://glygen.org/publication/PubMed/36780219" } ] }, { "title": "NPAS4 Exacerbates Pyroptosis via Transcriptionally Regulating NLRP6 in the Acute Phase of Intracerebral Hemorrhage in Mice.", "journal": "International journal of molecular sciences", "date": "2023-05-05", "authors": "Jian Dan, Qin Le, Gan Hui, Zheng Shuyue, Xiao Han, Duan Yuhao, Zhang Mi, Liang Ping, Zhao Jing, Zhai Xuan", "evidence": [ { "database": "RefSeq", "id": "NP_705781", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705781" } ], "reference": [ { "type": "PubMed", "id": "37176030", "url": "https://glygen.org/publication/PubMed/37176030" } ] } ], "pathway": [ { "id": "mmu:225872", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:225872", "resource": "KEGG Pathway" }, { "id": "R-MMU-9768919", "name": "NPAS4 regulates expression of target genes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9768919", "resource": "Reactome", "description": "NPAS4 regulates expression of target genes" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8CJH6-1", "protein_name": "Neuronal PAS domain-containing protein 4", "gene_name": "Npas4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLLHPEDLAHASSQHYRLLAENGDIQAEMVVRLQAKHGGWTWIYCMLYSDGPEGPITANNYPISDTEAWSLRQQLNSENTQAAYVLGTPAVLPSFSENVFSQEHCSNPLFTPALGTPRSASFPRAPELGVISTSEELAQPSKELDFSYLPFPARPEPSLQADLSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDPLTSSLQGQLTESSARSFEEQLTPCTSTFPDQLLPSTATFPEPLGSPTHEQLTPPSTAFQAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF", "length": 802 }, "evidence": [ { "id": "45230904", "url": "http://www.informatics.jax.org/homology/45230904", "database": "MGI" }, { "id": "Q8BGD7", "url": "https://omabrowser.org/oma/group/Q8BGD7/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8IUM7-1", "protein_name": "Neuronal PAS domain-containing protein 4", "gene_name": "NPAS4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKTGGWAWIYCLLYSEGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILSQEECSSTNPLFTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETSVRSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDNMFLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF", "length": 802 }, "evidence": [ { "id": "45230904", "url": "http://www.informatics.jax.org/homology/45230904", "database": "MGI" }, { "id": "Q8BGD7", "url": "https://omabrowser.org/oma/group/Q8BGD7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "learning", "id": "GO:0007612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007612", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "excitatory postsynaptic potential", "id": "GO:0060079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060079", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "short-term memory", "id": "GO:0007614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007614", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "regulation of synaptic plasticity", "id": "GO:0048167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048167", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "inhibitory postsynaptic potential", "id": "GO:0060080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060080", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "social behavior", "id": "GO:0035176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035176", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "long-term memory", "id": "GO:0007616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007616", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "cellular response to corticosterone stimulus", "id": "GO:0071386", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071386", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "regulation of synaptic transmission, GABAergic", "id": "GO:0032228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032228", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "inhibitory synapse assembly", "id": "GO:1904862", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904862", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "postsynapse", "id": "GO:0098794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" }, { "start_pos": 671, "end_pos": 673, "annotation": "n_glycosylation_sequon" }, { "start_pos": 745, "end_pos": 747, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated, leading to degradation by the proteosome.", "evidence": [ { "database": "UniProtKB", "id": "Q8BGD7", "url": "https://www.uniprot.org/uniprot/Q8BGD7" }, { "database": "PubMed", "id": "26663079", "url": "https://glygen.org/publication/PubMed/26663079" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }