{ "uniprot_canonical_ac": "Q8BFV2-1", "uniprot_ac": "Q8BFV2", "uniprot_id": "PCID2_MOUSE", "mass": { "chemical_mass": 46132.0, "monoisotopic_mass": 46132.0 }, "refseq": { "ac": "NP_848823", "name": "PCI domain-containing protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823" }, "gene_names": [ { "name": "Pcid2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q8BFV2", "id": "Q8BFV2" }, { "name": "A730042J05Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823", "id": "NP_848823" }, { "name": "Pcid2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823", "id": "NP_848823" } ], "protein_names": [ { "name": "PCI domain-containing protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q8BFV2" }, { "name": "CSN12-like protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823", "id": "NP_848823" }, { "name": "CSN12-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q8BFV2" }, { "name": "PCI domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823", "id": "NP_848823" } ], "function": [ { "annotation": "Pcid2 is essential for B cell survival through the regulation of MAD2 expression during B cell differentiation", "evidence": [ { "database": "RefSeq", "id": "NP_848823", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823" }, { "database": "PubMed", "id": "20870947", "url": "https://glygen.org/publication/PubMed/20870947" } ] }, { "annotation": "Pcid2 is present in the CBP/p300-EID1 complex to control the switch balance of mouse and human embryonic stem cells through modulation of EID1 degradation.", "evidence": [ { "database": "RefSeq", "id": "NP_848823", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823" }, { "database": "PubMed", "id": "24167073", "url": "https://glygen.org/publication/PubMed/24167073" } ] }, { "annotation": "Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation (PubMed:20870947). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (By similarity). Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and transcription-associated genomic instability (By similarity). Blocks the activity of the SRCAP chromatin remodeling complex by interacting with SRCAP complex member ZNHIT1 and inhibiting its interaction with the complex (PubMed:29138493). This prevents the deposition of histone variant H2AZ1/H2A.Z at the nucleosomes of key lymphoid fate regulator genes which suppresses their expression and restricts lymphoid lineage commitment (PubMed:29138493).", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2#function" }, { "database": "UniProtKB", "id": "Q5JVF3", "url": "https://www.uniprot.org/uniprot/Q5JVF3#function" }, { "database": "PubMed", "id": "20870947", "url": "https://glygen.org/publication/PubMed/20870947" }, { "database": "PubMed", "id": "29138493", "url": "https://glygen.org/publication/PubMed/29138493" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pcid2", "url": "https://www.uniprot.org/uniprot/Q8BFV2", "locus": { "chromosome": "8", "start_pos": 13127189, "end_pos": 13155459, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038542", "url": "https://www.ensembl.org/id/ENSMUSG00000038542" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038542", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038542", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "234069", "url": "https://www.ncbi.nlm.nih.gov/gene/234069", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8BFV2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8BFV2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000717", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000717", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:234069", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:234069", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2443003", "url": "http://www.informatics.jax.org/marker/MGI:2443003", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "INRMFTL", "url": "https://omabrowser.org/oma/group/INRMFTL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1491at2759", "url": "http://www.orthodb.org/?query=1491at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12732", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12732", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12732:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12732:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01399", "url": "http://pfam.xfam.org/family/PF01399", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q8BFV2", "url": "http://purl.obolibrary.org/obo/PR_Q8BFV2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_848823", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9Q1H5", "url": "https://www.uniprot.org/uniprot/E9Q1H5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q1H5-1", "url": "https://www.uniprot.org/uniprot/E9Q1H5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q5V9", "url": "https://www.uniprot.org/uniprot/E9Q5V9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q5V9-1", "url": "https://www.uniprot.org/uniprot/E9Q5V9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QZZ3", "url": "https://www.uniprot.org/uniprot/F6QZZ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QZZ3-1", "url": "https://www.uniprot.org/uniprot/F6QZZ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BFV2-1", "url": "https://www.uniprot.org/uniprot/Q8BFV2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRIFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRITYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTIELLRKYHLMQFSEVTKAVSEGNLLLLNEALAKHETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEVQCILANLIYMGHIKGYISHQHQKLVVSKQNPFPPLSTVC", "length": 399, "header": "sp|Q8BFV2-1|PCID2_MOUSE Isoform 1 of PCI domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=1 SV=1 CANONICAL=Q8BFV2-1" }, "isoforms": [ { "isoform_ac": "E9Q1H5-1", "url": "", "sequence": { "sequence": "MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRIFANNPCRHRRL", "length": 128, "header": "tr|E9Q1H5-1|E9Q1H5_MOUSE Computationally mapped isoform of PCI domain containing 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=1 SV=1 CANONICAL=Q8BFV2-1" }, "locus": { "chromosome": "8", "start_pos": 13154810, "end_pos": 13136306, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000172443.2", "url": "https://www.ensembl.org/id/ENSMUST00000172443.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000127622.2", "url": "https://www.ensembl.org/id/ENSMUSP00000127622.2" } ] } }, { "isoform_ac": "E9Q5V9-1", "url": "", "sequence": { "sequence": "MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQGSACHVCSST", "length": 52, "header": "tr|E9Q5V9-1|PCID2_MOUSE Computationally mapped isoform of PCI domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=1 SV=1 CANONICAL=Q8BFV2-1" }, "locus": { "chromosome": "8", "start_pos": 13154810, "end_pos": 13144168, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000168164.8", "url": "https://www.ensembl.org/id/ENSMUST00000168164.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000128207.2", "url": "https://www.ensembl.org/id/ENSMUSP00000128207.2" } ] } }, { "isoform_ac": "F6QZZ3-1", "url": "", "sequence": { "sequence": "XVLEPPYDEMFAAHLSKGAPLFS", "length": 23, "header": "tr|F6QZZ3-1|F6QZZ3_MOUSE Computationally mapped isoform of PCI domain containing 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=4 SV=1 CANONICAL=Q8BFV2-1" }, "locus": { "chromosome": "8", "start_pos": 13148607, "end_pos": 13148042, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000167198.2", "url": "https://www.ensembl.org/id/ENSMUST00000167198.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000130059.2", "url": "https://www.ensembl.org/id/ENSMUSP00000130059.2" } ] } }, { "isoform_ac": "Q8BFV2-1", "url": "", "sequence": { "sequence": "MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRIFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRITYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTIELLRKYHLMQFSEVTKAVSEGNLLLLNEALAKHETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEVQCILANLIYMGHIKGYISHQHQKLVVSKQNPFPPLSTVC", "length": 399, "header": "sp|Q8BFV2-1|PCID2_MOUSE Isoform 1 of PCI domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pcid2 PE=1 SV=1 CANONICAL=Q8BFV2-1" }, "locus": { "chromosome": "8", "start_pos": 13154810, "end_pos": 13128203, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000164416", "url": "https://www.ensembl.org/id/ENSMUST00000164416" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000133204", "url": "https://www.ensembl.org/id/ENSMUSP00000133204" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "site_lbl": "Ser45" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Critical role of Pcid2 in B cell survival through the regulation of MAD2 expression.", "journal": "J. Immunol.", "date": "2010", "authors": "Nakaya T, Kuwahara K, Ohta K, Kitabatake M, Toda T, Takeda N, Tani T, Kondo E, Sakaguchi N", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" }, { "database": "RefSeq", "id": "NP_848823", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823" } ], "reference": [ { "type": "PubMed", "id": "20870947", "url": "https://glygen.org/publication/PubMed/20870947" } ] }, { "title": "Pcid2 inactivates developmental genes in human and mouse embryonic stem cells to sustain their pluripotency by modulation of EID1 stability.", "journal": "Stem cells (Dayton, Ohio)", "date": "2014", "authors": "Ye B, Dai Z, Liu B, Wang R, Li C, Huang G, Wang S, Xia P, Yang X, Kuwahara K, Sakaguchi N, Fan Z", "evidence": [ { "database": "RefSeq", "id": "NP_848823", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_848823" } ], "reference": [ { "type": "PubMed", "id": "24167073", "url": "https://glygen.org/publication/PubMed/24167073" } ] }, { "title": "Suppression of SRCAP chromatin remodelling complex and restriction of lymphoid lineage commitment by Pcid2.", "journal": "Nat. Commun.", "date": "2017", "authors": "Ye B, Liu B, Yang L, Huang G, Hao L, Xia P, Wang S, Du Y, Qin X, Zhu P, Wu J, Sakaguchi N, Zhang J, Fan Z", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "reference": [ { "type": "PubMed", "id": "29138493", "url": "https://glygen.org/publication/PubMed/29138493" } ] } ], "pathway": [ { "id": "mmu:234069", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:234069", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F1MAF5-1", "protein_name": "PCI domain-containing protein 2", "gene_name": "Pcid2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAHITINQYLQQVYEAIDTRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTIELLRKYHLMQFSEVTRAVSEGNLLLLNEALAKHETFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMHVEDVDIDEVQCILANLIHMGHIKGYISHQHQKLVVSKQNPFPPLSTVC", "length": 399 }, "evidence": [ { "id": "45233327", "url": "http://www.informatics.jax.org/homology/45233327", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P47130-1", "protein_name": "Cop9 signalosome complex subunit 12", "gene_name": "CSN12", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MDVDIGCYFEEKRYDDKLLDFIRYDVKTPKKTKYILQRPTATDEESVRLQRFYQLGVDLKLKYSKRRSLKKQGRIKNATEELLRLANEQLKLFNRIVERETNWIIYPLWVMAKQLIRLANESSELNKDSIEECGRTIHRSFTICLNDRNPRLNENKKIGCYMFANLEFSIYHRLSNKDMIKNLVKVLESRVNARDIPPLNKSLAMEHKSQVVLYNYYLGQYYGCLENDHERGFFHLNEALLQCPMLYVESTGKFVLQGQMEKIMILLVPLALLTKRLYPHWDHPVIAGVITRSKRLSQVYPTLVRSVISGNLSLYEATAASHERFFLSQGLHVVITLLREVVFTRLVQRCWQWGNDRKSIMPLKILLATKQHDSSANEDEEEQLDALECRLASAIASGLLRAYLSHSNRCIVFSKKEPFPHSK", "length": 423 }, "evidence": [ { "id": "Q8BFV2", "url": "https://omabrowser.org/oma/group/Q8BFV2/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q5JVF3-1", "protein_name": "PCI domain-containing protein 2", "gene_name": "PCID2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC", "length": 399 }, "evidence": [ { "id": "45233327", "url": "http://www.informatics.jax.org/homology/45233327", "database": "MGI" }, { "id": "Q8BFV2", "url": "https://omabrowser.org/oma/group/Q8BFV2/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VTL1-1", "protein_name": "PCI domain-containing protein 2 homolog", "gene_name": "PCID2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLKDENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVCAADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKDSFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLILIYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL", "length": 395 }, "evidence": [ { "id": "Q8BFV2", "url": "https://omabrowser.org/oma/group/Q8BFV2/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "poly(A)+ mRNA export from nucleus", "id": "GO:0016973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016973", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "regulation of mRNA stability", "id": "GO:0043488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043488", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "spleen development", "id": "GO:0048536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048536", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "transcription elongation by RNA polymerase II", "id": "GO:0006368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006368", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "positive regulation of B cell differentiation", "id": "GO:0045579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045579", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery", "id": "GO:0000973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000973", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity", "id": "GO:2000117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000117", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "positive regulation of mitotic cell cycle spindle assembly checkpoint", "id": "GO:0090267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090267", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "negative regulation of transcription initiation by RNA polymerase II", "id": "GO:0060633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060633", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "heterochromatin organization", "id": "GO:0070828", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070828", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "negative regulation of lymphoid progenitor cell differentiation", "id": "GO:1905457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905457", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nuclear pore nuclear basket", "id": "GO:0044615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044615", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "transcription export complex 2", "id": "GO:0070390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070390", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "Q8BFV2", "url": "https://www.uniprot.org/uniprot/Q8BFV2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }