{ "uniprot_canonical_ac": "Q86TU7-1", "uniprot_ac": "Q86TU7", "uniprot_id": "SETD3_HUMAN", "mass": { "chemical_mass": 67257.0, "monoisotopic_mass": 67257.0 }, "refseq": { "ac": "NP_115609", "name": "actin-histidine N-methyltransferase isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, "gene_names": [ { "name": "SETD3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q86TU7", "id": "Q86TU7" }, { "name": "C14orf154; hSETD3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609", "id": "NP_115609" }, { "name": "C14orf154", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q86TU7", "id": "Q86TU7" }, { "name": "SETD3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609", "id": "NP_115609" } ], "protein_names": [ { "name": "Actin-histidine N-methyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q86TU7" }, { "name": "2.1.1.85", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86TU7" }, { "name": "Protein-L-histidine N-tele-methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86TU7" }, { "name": "SET domain-containing protein 3; histone-lysine N-methyltransferase setd3; actin-histidine N-methyltransferase; protein-L-histidine N-tele-methyltransferase; SET domain containing 3, actin histidine methyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609", "id": "NP_115609" }, { "name": "SET domain-containing protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86TU7" }, { "name": "actin-histidine N-methyltransferase isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609", "id": "NP_115609" }, { "name": "hSETD3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86TU7" } ], "function": [ { "annotation": "CircSETD3 mediates acquired resistance to gefitinib in non-small lung cancer cells by FXR1/ECT2 pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "36503048", "url": "https://glygen.org/publication/PubMed/36503048" } ] }, { "annotation": "Importance of Ile71 in beta-actin on histidine methyltransferase SETD3 catalysis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "35142326", "url": "https://glygen.org/publication/PubMed/35142326" } ] }, { "annotation": "MAF1, RNF7 and SETD3 are identified as PCNA-associated proteins in human cells and given this interaction with PCNA, Maf1, RNF7, and SetD3 are potentially involved in DNA replication, DNA repair, or associated processes.", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "26030842", "url": "https://glygen.org/publication/PubMed/26030842" } ] }, { "annotation": "Protein-histidine N-methyltransferase that specifically mediates 3-methylhistidine (tele-methylhistidine) methylation of actin at 'His-73' (PubMed:30526847, PubMed:30626964, PubMed:30785395, PubMed:31388018, PubMed:31993215). Histidine methylation of actin is required for smooth muscle contraction of the laboring uterus during delivery (PubMed:30626964). Does not have protein-lysine N-methyltransferase activity and probably only catalyzes histidine methylation of actin (PubMed:30626964, PubMed:30785395, PubMed:31388018).", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7#function" }, { "database": "PubMed", "id": "31388018", "url": "https://glygen.org/publication/PubMed/31388018" }, { "database": "PubMed", "id": "30626964", "url": "https://glygen.org/publication/PubMed/30626964" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" }, { "database": "PubMed", "id": "31993215", "url": "https://glygen.org/publication/PubMed/31993215" }, { "database": "PubMed", "id": "30526847", "url": "https://glygen.org/publication/PubMed/30526847" } ] }, { "annotation": "Proteolytic Activities of Enterovirus 2A Do Not Depend on Its Interaction with SETD3. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "35891342", "url": "https://glygen.org/publication/PubMed/35891342" } ] }, { "annotation": "Results show that high expression levels of SMYD2, SETD3, and NO66 in renal cell tumors. Their low expression levels were significantly associated with shorter disease-specific and disease-free survival.", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "26488939", "url": "https://glygen.org/publication/PubMed/26488939" } ] }, { "annotation": "Stabilization of SETD3 by deubiquitinase USP27 enhances cell proliferation and hepatocellular carcinoma progression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "35018513", "url": "https://glygen.org/publication/PubMed/35018513" } ] }, { "annotation": "Structure-function conservation between the methyltransferases SETD3 and SETD6.", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" }, { "database": "PubMed", "id": "35550916", "url": "https://glygen.org/publication/PubMed/35550916" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "Q86TU7", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q86TU7" } ], "glycoeffect": [], "start_pos": 460, "end_pos": 460, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "14", "chr_pos": "99399086", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R460", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 181, "end_pos": 185, "sequence_org": "SEYDT", "sequence_mut": "AEYDA", "comment": "Decreased ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "start_pos": 215, "end_pos": 215, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased binding to actin and decreased protein-histidine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" } ] }, { "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "A", "comment": "Decreased binding to actin and decreased protein-histidine N-methyltransferase activity. Increased protein-lysine methyltransferase activity toward an actin mutant with a Lys instead of a His target residue. Increased protein-methionine methyltransferase activity toward an actin mutant with a Met instead of a His target residue.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "31388018", "url": "https://glygen.org/publication/PubMed/31388018" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" }, { "database": "PubMed", "id": "32503840", "url": "https://glygen.org/publication/PubMed/32503840" } ] }, { "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "F", "comment": "Shows protein-lysine methyltransferase activity toward an actin mutant with a Lys instead of a His target residue; when associated with A-274.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "31911441", "url": "https://glygen.org/publication/PubMed/31911441" } ] }, { "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "V", "comment": "Decreased binding to actin and decreased protein-histidine N-methyltransferase activity. Increased protein-lysine methyltransferase activity toward an actin mutant with a Lys instead of a His target residue. Increased protein-methionine methyltransferase activity toward an actin mutant with a Met instead of a His target residue.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "31388018", "url": "https://glygen.org/publication/PubMed/31388018" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" }, { "database": "PubMed", "id": "32503840", "url": "https://glygen.org/publication/PubMed/32503840" } ] }, { "start_pos": 260, "end_pos": 264, "sequence_org": "TEDGS", "sequence_mut": "AEDGA", "comment": "Does not affect ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "start_pos": 274, "end_pos": 274, "sequence_org": "W", "sequence_mut": "A", "comment": "Shows protein-lysine methyltransferase activity toward an actin mutant with a Lys instead of a His target residue; when associated with F-256.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "31911441", "url": "https://glygen.org/publication/PubMed/31911441" } ] }, { "start_pos": 313, "end_pos": 313, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolished protein-histidine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "30626964", "url": "https://glygen.org/publication/PubMed/30626964" } ] }, { "start_pos": 313, "end_pos": 313, "sequence_org": "Y", "sequence_mut": "F", "comment": "Strongly decreased binding to actin and decreased protein-histidine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" } ] }, { "start_pos": 316, "end_pos": 316, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased binding to actin and decreased protein-histidine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "30785395", "url": "https://glygen.org/publication/PubMed/30785395" } ] }, { "start_pos": 373, "end_pos": 378, "sequence_org": "TEPPIS", "sequence_mut": "AEPPIA", "comment": "Strongly decreased ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "start_pos": 37, "end_pos": 42, "sequence_org": "SSPAPG", "sequence_mut": "ASPAPA", "comment": "Does not affect ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "start_pos": 512, "end_pos": 517, "sequence_org": "SSVGDS", "sequence_mut": "ASVGDA", "comment": "Does not affect ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "start_pos": 565, "end_pos": 569, "sequence_org": "SENES", "sequence_mut": "AENEA", "comment": "Does not affect ubiquitination and degradation by the SCF(FBXW7) complex.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "93.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "89.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "90.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "92.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q86TU7" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "common_name": "Human" } ], "gene": [ { "name": "SETD3", "url": "https://www.uniprot.org/uniprot/Q86TU7", "locus": { "chromosome": "14", "start_pos": 99397748, "end_pos": 99480889, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000183576", "url": "https://www.ensembl.org/id/ENSG00000183576" } ] } } ], "crossref": [ { "id": "ENSG00000183576", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183576", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "Q86TU7", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q86TU7", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.1.1.85", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.85&UniProtAcc=Q86TU7", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd19176", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19176", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "SETD3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SETD3", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "84193", "url": "https://www.ncbi.nlm.nih.gov/gene/84193", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "20493", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=20493", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q86TU7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q86TU7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001214", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001214", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025785", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025785", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036464", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036464", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044428", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044428", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:84193", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:84193", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "615671", "url": "http://www.omim.org/entry/615671", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q86TU7", "url": "https://www.nextprot.org/entry/NX_Q86TU7", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q86TU7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q86TU7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DFWMKIP", "url": "https://omabrowser.org/oma/group/DFWMKIP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "51002at2759", "url": "http://www.orthodb.org/?query=51002at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13271", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13271", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13271:SF47", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13271:SF47", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3SMT", "url": "https://www.rcsb.org/structure/3SMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ICT", "url": "https://www.rcsb.org/structure/6ICT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ICV", "url": "https://www.rcsb.org/structure/6ICV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JAT", "url": "https://www.rcsb.org/structure/6JAT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MBJ", "url": "https://www.rcsb.org/structure/6MBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MBK", "url": "https://www.rcsb.org/structure/6MBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MBL", "url": "https://www.rcsb.org/structure/6MBL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX0", "url": "https://www.rcsb.org/structure/6OX0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX1", "url": "https://www.rcsb.org/structure/6OX1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX2", "url": "https://www.rcsb.org/structure/6OX2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX3", "url": "https://www.rcsb.org/structure/6OX3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX4", "url": "https://www.rcsb.org/structure/6OX4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OX5", "url": "https://www.rcsb.org/structure/6OX5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V62", "url": "https://www.rcsb.org/structure/6V62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V63", "url": "https://www.rcsb.org/structure/6V63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WK1", "url": "https://www.rcsb.org/structure/6WK1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WK2", "url": "https://www.rcsb.org/structure/6WK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMS", "url": "https://www.rcsb.org/structure/7LMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W28", "url": "https://www.rcsb.org/structure/7W28", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W29", "url": "https://www.rcsb.org/structure/7W29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00856", "url": "http://pfam.xfam.org/family/PF00856", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09273", "url": "http://pfam.xfam.org/family/PF09273", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q86TU7", "url": "https://pharos.nih.gov/targets/Q86TU7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q86TU7", "url": "http://purl.obolibrary.org/obo/PR_Q86TU7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19369", "url": "https://www.rhea-db.org/rhea/19369", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "C9K0W5", "url": "https://www.uniprot.org/uniprot/C9K0W5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9K0W5-1", "url": "https://www.uniprot.org/uniprot/C9K0W5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NXR6", "url": "https://www.uniprot.org/uniprot/Q6NXR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NXR6-1", "url": "https://www.uniprot.org/uniprot/Q6NXR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86TU7-1", "url": "https://www.uniprot.org/uniprot/Q86TU7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86TU7-2", "url": "https://www.uniprot.org/uniprot/Q86TU7-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86TU7-3", "url": "https://www.uniprot.org/uniprot/Q86TU7-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSWDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE", "length": 594, "header": "sp|Q86TU7-1|SETD3_HUMAN Isoform 1 of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "isoforms": [ { "isoform_ac": "C9K0W5-1", "url": "", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGRRIVFMGSTKIANDC", "length": 81, "header": "tr|C9K0W5-1|SETD3_HUMAN Computationally mapped isoform of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "locus": { "chromosome": "14", "start_pos": 99465805, "end_pos": 99459139, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000357563.4", "url": "https://www.ensembl.org/id/ENST00000357563.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000350174.4", "url": "https://www.ensembl.org/id/ENSP00000350174.4" } ] } }, { "isoform_ac": "Q6NXR6-1", "url": "", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLVTTSSPVLC", "length": 292, "header": "tr|Q6NXR6-1|SETD3_HUMAN Computationally mapped isoform of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "locus": { "chromosome": "14", "start_pos": 99465805, "end_pos": 99412924, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436070.6", "url": "https://www.ensembl.org/id/ENST00000436070.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000408602.2", "url": "https://www.ensembl.org/id/ENSP00000408602.2" } ] } }, { "isoform_ac": "Q86TU7-1", "url": "", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSWDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE", "length": 594, "header": "sp|Q86TU7-1|SETD3_HUMAN Isoform 1 of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "locus": { "chromosome": "14", "start_pos": 99465805, "end_pos": 99398682, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000331768.10", "url": "https://www.ensembl.org/id/ENST00000331768.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000327436.5", "url": "https://www.ensembl.org/id/ENSP00000327436.5" } ] } }, { "isoform_ac": "Q86TU7-2", "url": "", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA", "length": 296, "header": "sp|Q86TU7-2|SETD3_HUMAN Isoform 2 of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "locus": { "chromosome": "14", "start_pos": 99465805, "end_pos": 99410177, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000329331.7", "url": "https://www.ensembl.org/id/ENST00000329331.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000327910.3", "url": "https://www.ensembl.org/id/ENSP00000327910.3" } ] } }, { "isoform_ac": "Q86TU7-3", "url": "", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLV", "length": 284, "header": "sp|Q86TU7-3|SETD3_HUMAN Isoform 3 of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1 CANONICAL=Q86TU7-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q86TU7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q86TU7" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [ { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q86TU7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q86TU7", "url": "http://phospho.elm.eu.org/byAccession/Q86TU7.html" } ], "site_lbl": "Ser12" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q86TU7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q86TU7", "url": "http://phospho.elm.eu.org/byAccession/Q86TU7.html" } ], "site_lbl": "Thr14" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q86TU7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" }, { "database": "phospho.ELM", "id": "Q86TU7", "url": "http://phospho.elm.eu.org/byAccession/Q86TU7.html" } ], "site_lbl": "Thr17" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q86TU7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7" }, { "database": "phospho.ELM", "id": "Q86TU7", "url": "http://phospho.elm.eu.org/byAccession/Q86TU7.html" } ], "site_lbl": "Ser513" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Regulation of chromatin structure by site-specific histone H3 methyltransferases.", "journal": "Nature", "date": "2000", "authors": "Rea S, Eisenhaber F, O'Carroll D, Strahl BD, Sun ZW, Schmid M, Opravil S, Mechtler K, Ponting CP, Allis CD, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "10949293", "url": "https://glygen.org/publication/PubMed/10949293" } ] }, { "title": "SETDB1: a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.", "journal": "Genes & development", "date": "2002", "authors": "Schultz DC, Ayyanathan K, Negorev D, Maul GG, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "11959841", "url": "https://glygen.org/publication/PubMed/11959841" } ] }, { "title": "Methylation of H3-lysine 79 is mediated by a new family of HMTases without a SET domain.", "journal": "Current biology : CB", "date": "2002", "authors": "Feng Q, Wang H, Ng HH, Erdjument-Bromage H, Tempst P, Struhl K, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12123582", "url": "https://glygen.org/publication/PubMed/12123582" } ] }, { "title": "G9a histone methyltransferase plays a dominant role in euchromatic histone H3 lysine 9 methylation and is essential for early embryogenesis.", "journal": "Genes & development", "date": "2002", "authors": "Tachibana M, Sugimoto K, Nozaki M, Ueda J, Ohta T, Ohki M, Fukuda M, Takeda N, Niida H, Kato H, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12130538", "url": "https://glygen.org/publication/PubMed/12130538" } ] }, { "title": "MLL targets SET domain methyltransferase activity to Hox gene promoters.", "journal": "Molecular cell", "date": "2002", "authors": "Milne TA, Briggs SD, Brock HW, Martin ME, Gibbs D, Allis CD, Hess JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12453418", "url": "https://glygen.org/publication/PubMed/12453418" } ] }, { "title": "Structure and catalytic mechanism of the human histone methyltransferase SET7/9.", "journal": "Nature", "date": "2003", "authors": "Xiao B, Jing C, Wilson JR, Walker PA, Vasisht N, Kelly G, Howell S, Taylor IA, Blackburn GM, Gamblin SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12540855", "url": "https://glygen.org/publication/PubMed/12540855" } ] }, { "title": "Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.", "journal": "Genes & development", "date": "2003", "authors": "Wysocka J, Myers MP, Laherty CD, Eisenman RN, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12670868", "url": "https://glygen.org/publication/PubMed/12670868" } ] }, { "title": "mAM facilitates conversion by ESET of dimethyl to trimethyl lysine 9 of histone H3 to cause transcriptional repression.", "journal": "Molecular cell", "date": "2003", "authors": "Wang H, An W, Cao R, Xia L, Erdjument-Bromage H, Chatton B, Tempst P, Roeder RG, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14536086", "url": "https://glygen.org/publication/PubMed/14536086" } ] }, { "title": "Histone methyltransferases direct different degrees of methylation to define distinct chromatin domains.", "journal": "Molecular cell", "date": "2003", "authors": "Rice JC, Briggs SD, Ueberheide B, Barber CM, Shabanowitz J, Hunt DF, Shinkai Y, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14690610", "url": "https://glygen.org/publication/PubMed/14690610" } ] }, { "title": "Menin associates with a trithorax family histone methyltransferase complex and with the hoxc8 locus.", "journal": "Molecular cell", "date": "2004", "authors": "Hughes CM, Rozenblatt-Rosen O, Milne TA, Copeland TD, Levine SS, Lee JC, Hayes DN, Shanmugam KS, Bhattacharjee A, Biondi CA, Kay GF, Hayward NK, Hess JL, Meyerson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14992727", "url": "https://glygen.org/publication/PubMed/14992727" } ] }, { "title": "A silencing pathway to induce H3-K9 and H4-K20 trimethylation at constitutive heterochromatin.", "journal": "Genes & development", "date": "2004", "authors": "Schotta G, Lachner M, Sarma K, Ebert A, Sengupta R, Reuter G, Reinberg D, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15145825", "url": "https://glygen.org/publication/PubMed/15145825" } ] }, { "title": "SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells.", "journal": "Nature cell biology", "date": "2004", "authors": "Hamamoto R, Furukawa Y, Morita M, Iimura Y, Silva FP, Li M, Yagyu R, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15235609", "url": "https://glygen.org/publication/PubMed/15235609" } ] }, { "title": "SET8 recognizes the sequence RHRK20VLRDN within the N terminus of histone H4 and mono-methylates lysine 20.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Yin Y, Liu C, Tsai SN, Zhou B, Ngai SM, Zhu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15964846", "url": "https://glygen.org/publication/PubMed/15964846" } ] }, { "title": "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.", "journal": "Nature methods", "date": "2005", "authors": "Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R", "evidence": [ { "database": "iPTMnet", "id": "Q86TU7-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7-1" } ], "reference": [ { "type": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" } ] }, { "title": "Identification and characterization of a novel human histone H3 lysine 36-specific methyltransferase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Sun XJ, Wei J, Wu XY, Hu M, Wang L, Wang HH, Zhang QH, Chen SJ, Huang QH, Chen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16118227", "url": "https://glygen.org/publication/PubMed/16118227" } ] }, { "title": "MLL associates specifically with a subset of transcriptionally active target genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Milne TA, Dou Y, Martin ME, Brock HW, Roeder RG, Hess JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16199523", "url": "https://glygen.org/publication/PubMed/16199523" } ] }, { "title": "A histone H3 methyltransferase controls epigenetic events required for meiotic prophase.", "journal": "Nature", "date": "2005", "authors": "Hayashi K, Yoshida K, Matsui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16292313", "url": "https://glygen.org/publication/PubMed/16292313" } ] }, { "title": "Catalytic properties and kinetic mechanism of human recombinant Lys-9 histone H3 methyltransferase SUV39H1: participation of the chromodomain in enzymatic catalysis.", "journal": "Biochemistry", "date": "2006", "authors": "Chin HG, Patnaik D, Esteve PO, Jacobsen SE, Pradhan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16519522", "url": "https://glygen.org/publication/PubMed/16519522" } ] }, { "title": "Characterization of a novel WHSC1-associated SET domain protein with H3K4 and H3K27 methyltransferase activity.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Kim SM, Kee HJ, Eom GH, Choe NW, Kim JY, Kim YS, Kim SK, Kook H, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16682010", "url": "https://glygen.org/publication/PubMed/16682010" } ] }, { "title": "Identification and characterization of Smyd2: a split SET/MYND domain-containing histone H3 lysine 36-specific methyltransferase that interacts with the Sin3 histone deacetylase complex.", "journal": "Molecular cancer", "date": "2006", "authors": "Brown MA, Sims RJ 3rd, Gottlieb PD, Tucker PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16805913", "url": "https://glygen.org/publication/PubMed/16805913" } ] }, { "title": "Coactivator as a target gene specificity determinant for histone H3 lysine 4 methyltransferases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Lee S, Lee DK, Dou Y, Lee J, Lee B, Kwak E, Kong YY, Lee SK, Roeder RG, Lee JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17021013", "url": "https://glygen.org/publication/PubMed/17021013" } ] }, { "title": "PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Cho YW, Hong T, Hong S, Guo H, Yu H, Kim D, Guszczynski T, Dressler GR, Copeland TD, Kalkum M, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17500065", "url": "https://glygen.org/publication/PubMed/17500065" } ] }, { "title": "Trithorax-group protein ASH1 methylates histone H3 lysine 36.", "journal": "Gene", "date": "2007", "authors": "Tanaka Y, Katagiri Z, Kawahashi K, Kioussis D, Kitajima S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17544230", "url": "https://glygen.org/publication/PubMed/17544230" } ] }, { "title": "Activator-mediated recruitment of the MLL2 methyltransferase complex to the beta-globin locus.", "journal": "Molecular cell", "date": "2007", "authors": "Demers C, Chaturvedi CP, Ranish JA, Juban G, Lai P, Morle F, Aebersold R, Dilworth FJ, Groudine M, Brand M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17707229", "url": "https://glygen.org/publication/PubMed/17707229" } ] }, { "title": "Multiple-myeloma-related WHSC1/MMSET isoform RE-IIBP is a histone methyltransferase with transcriptional repression activity.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Kim JY, Kee HJ, Choe NW, Kim SM, Eom GH, Baek HJ, Kook H, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "18172012", "url": "https://glygen.org/publication/PubMed/18172012" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "iPTMnet", "id": "Q86TU7-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "The target of the NSD family of histone lysine methyltransferases depends on the nature of the substrate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Li Y, Trojer P, Xu CF, Cheung P, Kuo A, Drury WJ 3rd, Qiao Q, Neubert TA, Xu RM, Gozani O, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "19808676", "url": "https://glygen.org/publication/PubMed/19808676" } ] }, { "title": "Lysine methylation of the NF-kappaB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-kappaB signaling.", "journal": "Nature immunology", "date": "2011", "authors": "Levy D, Kuo AJ, Chang Y, Schaefer U, Kitson C, Cheung P, Espejo A, Zee BM, Liu CL, Tangsombatvisit S, Tennen RI, Kuo AY, Tanjing S, Cheung R, Chua KF, Utz PJ, Shi X, Prinjha RK, Lee K, Garcia BA, Bedford MT, Tarakhovsky A, Cheng X, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21131967", "url": "https://glygen.org/publication/PubMed/21131967" } ] }, { "title": "The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Qiao Q, Li Y, Chen Z, Wang M, Reinberg D, Xu RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21196496", "url": "https://glygen.org/publication/PubMed/21196496" } ] }, { "title": "Structural and functional profiling of the human histone methyltransferase SMYD3.", "journal": "PloS one", "date": "2011", "authors": "Foreman KW, Brown M, Park F, Emtage S, Harriss J, Das C, Zhu L, Crew A, Arnold L, Shaaban S, Tucker P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21779408", "url": "https://glygen.org/publication/PubMed/21779408" } ] }, { "title": "Histone methyltransferase SETD3 regulates muscle differentiation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Eom GH, Kim KB, Kim JH, Kim JY, Kim JR, Kee HJ, Kim DW, Choe N, Park HJ, Son HJ, Choi SY, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21832073", "url": "https://glygen.org/publication/PubMed/21832073" } ] }, { "title": "NSD2 links dimethylation of histone H3 at lysine 36 to oncogenic programming.", "journal": "Molecular cell", "date": "2011", "authors": "Kuo AJ, Cheung P, Chen K, Zee BM, Kioi M, Lauring J, Xi Y, Park BH, Shi X, Garcia BA, Li W, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "22099308", "url": "https://glygen.org/publication/PubMed/22099308" } ] }, { "title": "Prdm3 and Prdm16 are H3K9me1 methyltransferases required for mammalian heterochromatin integrity.", "journal": "Cell", "date": "2012", "authors": "Pinheiro I, Margueron R, Shukeir N, Eisold M, Fritzsch C, Richter FM, Mittler G, Genoud C, Goyama S, Kurokawa M, Son J, Reinberg D, Lachner M, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "22939622", "url": "https://glygen.org/publication/PubMed/22939622" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "iPTMnet", "id": "Q86TU7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "A fluorescent bimolecular complementation screen reveals MAF1, RNF7 and SETD3 as PCNA-associated proteins in human cells.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Cooper SE, Hodimont E, Green CM", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "26030842", "url": "https://glygen.org/publication/PubMed/26030842" } ] }, { "title": "Expression of histone methyltransferases as novel biomarkers for renal cell tumor diagnosis and prognostication.", "journal": "Epigenetics", "date": "2015", "authors": "Pires-Luis AS, Vieira-Coimbra M, Vieira FQ, Costa-Pinheiro P, Silva-Santos R, Dias PC, Antunes L, Lobo F, Oliveira J, Goncalves CS, Costa BM, Henrique R, Jeronimo C", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "26488939", "url": "https://glygen.org/publication/PubMed/26488939" } ] }, { "title": "Cell cycle-dependent degradation of the methyltransferase SETD3 attenuates cell proliferation and liver tumorigenesis.", "journal": "J. Biol. Chem.", "date": "2017", "authors": "Cheng X, Hao Y, Shu W, Zhao M, Zhao C, Wu Y, Peng X, Yao P, Xiao D, Qing G, Pan Z, Yin L, Hu D, Du HN", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q86TU7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "SETD3 is an actin histidine methyltransferase that prevents primary dystocia.", "journal": "Nature", "date": "2019", "authors": "Wilkinson AW, Diep J, Dai S, Liu S, Ooi YS, Song D, Li TM, Horton JR, Zhang X, Liu C, Trivedi DV, Ruppel KM, Vilches-Moure JG, Casey KM, Mak J, Cowan T, Elias JE, Nagamine CM, Spudich JA, Cheng X, Carette JE, Gozani O", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "30626964", "url": "https://glygen.org/publication/PubMed/30626964" } ] }, { "title": "Structural basis for the target specificity of actin histidine methyltransferase SETD3.", "journal": "Nat. Commun.", "date": "2019", "authors": "Dai S, Horton JR, Woodcock CB, Wilkinson AW, Zhang X, Gozani O, Cheng X", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "31388018", "url": "https://glygen.org/publication/PubMed/31388018" } ] }, { "title": "An engineered variant of SETD3 methyltransferase alters target specificity from histidine to lysine methylation.", "journal": "J. Biol. Chem.", "date": "2020", "authors": "Dai S, Horton JR, Wilkinson AW, Gozani O, Zhang X, Cheng X", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "31911441", "url": "https://glygen.org/publication/PubMed/31911441" } ] }, { "title": "Molecular basis for histidine N3-specific methylation of actin H73 by SETD3.", "journal": "Cell Discov.", "date": "2020", "authors": "Zheng Y, Zhang X, Li H", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "31993215", "url": "https://glygen.org/publication/PubMed/31993215" } ] }, { "title": "Characterization of SETD3 methyltransferase-mediated protein methionine methylation.", "journal": "J. Biol. Chem.", "date": "2020", "authors": "Dai S, Holt MV, Horton JR, Woodcock CB, Patel A, Zhang X, Young NL, Wilkinson AW, Cheng X", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "reference": [ { "type": "PubMed", "id": "32503840", "url": "https://glygen.org/publication/PubMed/32503840" } ] }, { "title": "Stabilization of SETD3 by deubiquitinase USP27 enhances cell proliferation and hepatocellular carcinoma progression.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2022", "authors": "Zou T, Wang Y, Dong L, Che T, Zhao H, Yan X, Lin Z", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "35018513", "url": "https://glygen.org/publication/PubMed/35018513" } ] }, { "title": "Importance of Ile71 in beta-actin on histidine methyltransferase SETD3 catalysis.", "journal": "Organic & biomolecular chemistry", "date": "2022", "authors": "Bilgin N, Moesgaard L, Maas MN, Hintzen JCJ, Witecka A, Drozak J, Kongsted J, Mecinovic J", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "35142326", "url": "https://glygen.org/publication/PubMed/35142326" } ] }, { "title": "Structure-function conservation between the methyltransferases SETD3 and SETD6.", "journal": "Biochimie", "date": "2022", "authors": "Admoni-Elisha L, Abaev-Schneiderman E, Cohn O, Shapira G, Shomron N, Feldman M, Levy D", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "35550916", "url": "https://glygen.org/publication/PubMed/35550916" } ] }, { "title": "Proteolytic Activities of Enterovirus 2A Do Not Depend on Its Interaction with SETD3.", "journal": "Viruses", "date": "2022", "authors": "Yang X, Aloise C, van Vliet ALW, Zwaagstra M, Lyoo H, Cheng A, van Kuppeveld FJM", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "35891342", "url": "https://glygen.org/publication/PubMed/35891342" } ] }, { "title": "CircSETD3 mediates acquired resistance to gefitinib in non-small lung cancer cells by FXR1/ECT2 pathway.", "journal": "The international journal of biochemistry & cell biology", "date": "2023-01", "authors": "Wen Chunjie, Li Yaji, Huang Yutang, Wang Nan, He Shuai, Bao Meihua, Zhou Honghao, Wu Lanxiang", "evidence": [ { "database": "RefSeq", "id": "NP_115609", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115609" } ], "reference": [ { "type": "PubMed", "id": "36503048", "url": "https://glygen.org/publication/PubMed/36503048" } ] } ], "pathway": [ { "id": "hsa:84193", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:84193", "resource": "KEGG Pathway" }, { "id": "R-HSA-3214841", "name": "PKMTs methylate histone lysines", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841", "resource": "Reactome", "description": "PKMTs methylate histone lysines" } ], "orthologs": [ { "uniprot_canonical_ac": "G3V6U9-1", "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYTQIRALVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSILGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFQAGDQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSWDNEVKLWTFLEDRASLLLKTYKTTIEEDKTVLKNPDLSVRATMAIKLRLGEKEILEKAVKSAAMNREYYRKHMEERAPLPRYEESDLGLLEGGVGDSRLPLVLRKLEEEAGVQESLSLTETVSKVKAAENGLVNGESLIPNGTRSENESLSPEESENTTGDTEESSGSMDAVKERL", "length": 596 }, "evidence": [ { "id": "Q86TU7", "url": "https://omabrowser.org/oma/group/Q86TU7/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q91WC0-1", "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPSPGKEWEEYTQIRALVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEEEVRCLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKESFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFQAGDQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFALHSTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNAEFPVSWDNEVKLWTFLEDRASLLLKTYKTTIEEDKIVLKNPDLSVRATMAIKLRLGEKEILEKAVKSAAVNREYYRKHMEERAPLPRYEESDLGLLEGGVGDSRLPLVLRKLEEEAGVQESLSLTETVSKVKAAENGLVNGENLIPNGTRSENESLSPEESENVTGEESSGSMAKVKERL", "length": 594 }, "evidence": [ { "id": "45231837", "url": "http://www.informatics.jax.org/homology/45231837", "database": "MGI" }, { "id": "Q86TU7", "url": "https://omabrowser.org/oma/group/Q86TU7/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9W3U1-1", "protein_name": "Actin-histidine N-methyltransferase", "gene_name": "Setd3", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MGKNTKRNKKTKQQQQQPQQNGVTASASGTAVEDFEDQQAASSLPSLNGKKRSQLNKLVEELLDLVEKQPANPNEEWKQYGQLQELLKQIMILEEPLSQAVCPQISDSPDDQTRLAKVEAFSAWAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFGKMTQATHLNLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVLYFTTKQMELLRGTAAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGLCYKLYRWAVSTVMTRQNLVPSEKQESEDGPKLISALIPYWDMANHRPGKITSFYATVSRQLECTAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDPNNTKDYVNIRVGLSLTDALAAKRASILDKLNIRHTAELRVLPAPDFISKELLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETRTWQFLEDRLKLLLAVFNKEMHEADEVKELELKDGQEIELMLFLYRRLERSILAGALQYAQEHRKV", "length": 537 }, "evidence": [ { "id": "Q86TU7", "url": "https://omabrowser.org/oma/group/Q86TU7/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "actin modification", "id": "GO:0030047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030047", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "peptidyl-histidine methylation", "id": "GO:0018021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018021", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "positive regulation of muscle cell differentiation", "id": "GO:0051149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051149", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "peptidyl-lysine monomethylation", "id": "GO:0018026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018026", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "peptidyl-lysine dimethylation", "id": "GO:0018027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018027", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "regulation of uterine smooth muscle contraction", "id": "GO:0070472", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070472", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "protein-L-histidine N-tele-methyltransferase activity", "id": "GO:0018064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018064", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "histone H3K4 methyltransferase activity", "id": "GO:0042800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042800", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "histone H3K36 methyltransferase activity", "id": "GO:0046975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046975", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 278, "end_pos": 280, "annotation": "n_glycosylation_sequon" }, { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" }, { "start_pos": 331, "end_pos": 333, "annotation": "n_glycosylation_sequon" }, { "start_pos": 561, "end_pos": 563, "annotation": "n_glycosylation_sequon" }, { "start_pos": 567, "end_pos": 569, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by GSK3B, which is required for recognition by the SCF(FBXW7) complex and subsequent degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] }, { "annotation": "Ubiquitinated by the SCF(FBXW7) complex following phosphorylation by GSK3B, leading to its degradation by the proteasome.", "evidence": [ { "database": "UniProtKB", "id": "Q86TU7", "url": "https://www.uniprot.org/uniprot/Q86TU7" }, { "database": "PubMed", "id": "28442573", "url": "https://glygen.org/publication/PubMed/28442573" } ] } ], "interactions": [], "reactions": [ { "id": "19369", "name": "", "equation": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "G3V6U9-1", "Q4KM84-1", "Q86TU7-1", "O95568-1", "Q91WC0-1", "Q9CZ09-1", "P40481-1", "Q55D68-1", "Q55DL2-1", "Q9W3U1-1" ], "evidence": [ { "id": "19369", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19369" } ] }, { "id": "R-HSA-5159245", "name": "SETD3, SETD7 (KMT7), WHSC1L1 (KMT3F), Core MLL complex methylate lysine-5 of histone H3 (H3K4)", "equation": "", "summary": "Tri-methylation of lysine-5 of histone H3 (H3K4) has been linked to transcriptional activation in a variety of eukaryotic species (Ruthenberg et al. 2007). Several H3K4 methyltransferases have been identified in mammals, predominantly members of the Mixed Lineage Leukemia (MLL) protein family. Five of these, KMT2A (MML1), KMT2D (MLL2), KMT2C (MLL3), KMT2B (MLL4) and SETD1A (KMT2F) have been shown to display H3K4 mono-, di- and tri-methyltransferase activity (Milne et al. 2002, Hughes et al. 2004, Cho et al. 2007, Wysocka et al. 2003). KMT2G (SETD1B) is believed to have similar activity on the basis of sequence homology (Ruthenberg et al. 2007). MLLs are a component of large multiprotein complexes that also include WDR5, RBBP5, ASH2 and DPY30, assembled to form the core MLL complex (Nakamura et al. 2002, Hughes et al. 2004, Dou et al. 2006, Tremblay et al. 2014). The WD40 domain of WDR5 recognizes and binds the histone H3 N-terminus, presenting the lysine-4 side chain for methylation by one of the catalytically active MLL family (Couture et al. 2006, Ruthenburg et al. 2006). Histone H3 recognition by WDR5 is regulated by the methylation state of adjacent arginine (H3R2) residue. H3R2 methylation abolishes WDR5 interaction with the H3 histone tail (Couture et al. 2006); H3K4 di-/trimethylation and H3R2 methylation have an inverse relationship (Guccione et al. 2006).

SETD7 (KMT7, SET9, SET7/9) is an H3K4 mono-methytransferase (Wang et al. 2001, Xiao et al. 2003, Hu & Zhang 2006) that can also methylate a wide range of non-histone proteins (Dhayalan et al. 2011). SETD3 can mono- and di-methylate H3K4 and H3K36 (Eom et al. 2011).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8WTS6-1", "O14686-1", "Q03164-1", "O15047-1", "Q8NEZ4-1", "Q9UMN6-1", "Q9UPS6-1", "Q86TU7-1", "Q9BZ95-1" ], "evidence": [ { "id": "R-HSA-5159245", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5159245" } ] }, { "id": "R-HSA-5637686", "name": "WHSC1L1 (KMT3F), Core MLL complex, SMYD3 (KMT3E) methylate methyl-lysine-5 of histone H3 (H3K4)", "equation": "", "summary": "Trimethylation of lysine-5 of histone H3 (H3K4) has been linked to transcriptional activation in a variety of eukaryotic species (Ruthenberg et al. 2007). Several H3K4 methyltransferases have been identified in mammals, predominantly members of the Mixed Lineage Leukemia (MLL) protein family. Five of these, KMT2A (MML1), KMT2D (MLL2), KMT2C (MLL3), KMT2B (MLL4) and SETD1A (KMT2F) have been shown to display H3K4 mono-, di- and tri-methyltransferase activity (Milne et al. 2002, Hughes et al. 2004, Cho et al. 2007, Wysocka et al. 2003). KMT2G (SETD1B) is believed to have similar activity on the basis of sequence homology (Ruthenberg et al. 2007). MLLs are a component of large multiprotein complexes that also include WDR5, RBBP5, ASH2 and DPY30, assembled to form the core MLL complex (Nakamura et al. 2002, Hughes et al. 2004, Dou et al. 2006, Tremblay et al. 2014). The WD40 domain of WDR5 recognizes and binds the histone H3 N-terminus, presenting the lysine-4 side chain for methylation by one of the catalytically active MLL family (Couture et al. 2006, Ruthenburg et al. 2006). Histone H3 recognition by WDR5 is regulated by the methylation state of the adjacent arginine (H3R2) residue. H3R2 methylation abolishes WDR5 interaction with the H3 histone tail (Couture et al. 2006); H3K4 di-/trimethylation and H3R2 methylation have an inverse relationship (Guccione et al. 2006). ; ; WHSC1L1 (KMT3F, WHISTLE), SMYD3 (KMT3E) and SETD3 are able to di-methylate H3K4 (Kim et al. 2006, Hamamoto et al. 2004, Eom et al. 2011).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O14686-1", "Q03164-1", "O15047-1", "Q8NEZ4-1", "Q9UMN6-1", "Q9UPS6-1", "Q9H7B4-1", "Q86TU7-1", "Q9BZ95-1" ], "evidence": [ { "id": "R-HSA-5637686", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5637686" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "G3V6U9", "gene_name": "Setd3", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "G3V6U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V6U9" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "G3V6U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V6U9" } ] } ] }, { "uniprot_ac": "O14686", "gene_name": "KMT2D", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O14686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14686" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "O14686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14686" } ] } ] }, { "uniprot_ac": "O15047", "gene_name": "SETD1A", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O15047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15047" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "O15047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15047" } ] } ] }, { "uniprot_ac": "O95568", "gene_name": "METTL18", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O95568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95568" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "O95568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95568" } ] } ] }, { "uniprot_ac": "P40481", "gene_name": "HPM1", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P40481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40481" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "P40481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40481" } ] } ] }, { "uniprot_ac": "Q03164", "gene_name": "KMT2A", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q03164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03164" } ] }, { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q03164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03164" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q03164", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03164" } ] } ] }, { "uniprot_ac": "Q4KM84", "gene_name": "Mettl18", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q4KM84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM84" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q4KM84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM84" } ] } ] }, { "uniprot_ac": "Q55D68", "gene_name": "cnrI", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q55D68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D68" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q55D68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D68" } ] } ] }, { "uniprot_ac": "Q55DL2", "gene_name": "", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q55DL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DL2" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q55DL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DL2" } ] } ] }, { "uniprot_ac": "Q86TU7", "gene_name": "SETD3", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q86TU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q86TU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86TU7" } ] } ] }, { "uniprot_ac": "Q8NEZ4", "gene_name": "KMT2C", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8NEZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEZ4" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8NEZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEZ4" } ] } ] }, { "uniprot_ac": "Q8WTS6", "gene_name": "SETD7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] } ] }, { "uniprot_ac": "Q91WC0", "gene_name": "Setd3", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q91WC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WC0" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q91WC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WC0" } ] } ] }, { "uniprot_ac": "Q9BZ95", "gene_name": "NSD3", "activity": [ { "ec_number": "2.1.1.370", "activity": "L-lysyl(4)-[histone H3] + 2 S-adenosyl-L-methionine = 2 H(+) + N(6),N(6)-dimethyl-L-lysyl(4)-[histone H3] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9BZ95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZ95" } ] }, { "ec_number": "2.1.1.371", "activity": "L-lysyl(27)-[histone H3] + 2 S-adenosyl-L-methionine = 2 H(+) + N(6),N(6)-dimethyl-L-lysyl(27)-[histone H3] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9BZ95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZ95" } ] }, { "ec_number": "2.1.1.370", "activity": "", "evidence": [ { "id": "Q9BZ95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZ95" } ] }, { "ec_number": "2.1.1.371", "activity": "", "evidence": [ { "id": "Q9BZ95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZ95" } ] } ] }, { "uniprot_ac": "Q9CZ09", "gene_name": "Mettl18", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9CZ09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZ09" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q9CZ09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZ09" } ] } ] }, { "uniprot_ac": "Q9H7B4", "gene_name": "SMYD3", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9H7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7B4" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q9H7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7B4" } ] } ] }, { "uniprot_ac": "Q9UMN6", "gene_name": "KMT2B", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9UMN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UMN6" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q9UMN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UMN6" } ] } ] }, { "uniprot_ac": "Q9UPS6", "gene_name": "SETD1B", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9UPS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPS6" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q9UPS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPS6" } ] } ] }, { "uniprot_ac": "Q9W3U1", "gene_name": "Setd3", "activity": [ { "ec_number": "2.1.1.85", "activity": "L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9W3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3U1" } ] }, { "ec_number": "2.1.1.85", "activity": "", "evidence": [ { "id": "Q9W3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3U1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }