{ "uniprot_canonical_ac": "Q86KR9-1", "uniprot_ac": "Q86KR9", "uniprot_id": "P4HA_DICDI", "mass": { "chemical_mass": 33348.0, "monoisotopic_mass": 33348.0 }, "refseq": { "ac": "XP_642496", "name": "prolyl 4-hydroxylase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642496" }, "gene_names": [ { "name": "phyA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q86KR9", "id": "Q86KR9" }, { "name": "DDB_G0277759", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q86KR9", "id": "Q86KR9" }, { "name": "p4h1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q86KR9", "id": "Q86KR9" }, { "name": "phyA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642496", "id": "XP_642496" } ], "protein_names": [ { "name": "Prolyl 4-hydroxylase subunit alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q86KR9" }, { "name": "1.14.11.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86KR9" }, { "name": "Prolyl 4-hydrolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86KR9" }, { "name": "prolyl 4-hydroxylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642496", "id": "XP_642496" } ], "function": [ { "annotation": "Catalyzes the post-translational formation of 4-hydroxyproline. Probably hydroxylates skp1 on Pro-143.", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9#function" }, { "database": "PubMed", "id": "11358877", "url": "https://glygen.org/publication/PubMed/11358877" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "phyA", "url": "https://www.uniprot.org/uniprot/Q86KR9", "locus": {} } ], "crossref": [ { "id": "1.14.11.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.11.2&UniProtAcc=Q86KR9", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "DDB_G0277759", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8621207", "url": "https://www.ncbi.nlm.nih.gov/gene/8621207", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006620", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006620", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044862", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044862", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0277759", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277759", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FEPRIAI", "url": "https://omabrowser.org/oma/group/FEPRIAI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR12907", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12907", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12907:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12907:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6T8M", "url": "https://www.rcsb.org/structure/6T8M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13640", "url": "http://pfam.xfam.org/family/PF13640", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q86KR9", "url": "http://purl.obolibrary.org/obo/PR_Q86KR9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_642496", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642496", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "48936", "url": "https://www.rhea-db.org/rhea/48936", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86KR9-1", "url": "https://www.uniprot.org/uniprot/Q86KR9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDISNLPPHIRQQILGLISKPQQNNDESSSSNNKNNLINNEKVSNVLIDLTSNLKIENFKIFNKESLNQLEKKGYLIIDNFLNDLNKINLIYDESYNQFKENKLIEAGMNKGTDKWKDKSIRGDYIQWIHRDSNSRIQDKDLSSTIRNINYLLDKLDLIKNEFDNVIPNFNSIKTQTQLAVYLNGGRYIKHRDSFYSSESLTISRRITMIYYVNKDWKKGDGGELRLYTNNPNNTNQKELKQTEEFIDIEPIADRLLIFLSPFLEHEVLQCNFEPRIAITTWIY", "length": 284, "header": "sp|Q86KR9-1|P4HA_DICDI Isoform 1 of Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1 CANONICAL=Q86KR9-1" }, "isoforms": [ { "isoform_ac": "Q86KR9-1", "url": "", "sequence": { "sequence": "MDISNLPPHIRQQILGLISKPQQNNDESSSSNNKNNLINNEKVSNVLIDLTSNLKIENFKIFNKESLNQLEKKGYLIIDNFLNDLNKINLIYDESYNQFKENKLIEAGMNKGTDKWKDKSIRGDYIQWIHRDSNSRIQDKDLSSTIRNINYLLDKLDLIKNEFDNVIPNFNSIKTQTQLAVYLNGGRYIKHRDSFYSSESLTISRRITMIYYVNKDWKKGDGGELRLYTNNPNNTNQKELKQTEEFIDIEPIADRLLIFLSPFLEHEVLQCNFEPRIAITTWIY", "length": 284, "header": "sp|Q86KR9-1|P4HA_DICDI Isoform 1 of Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1 CANONICAL=Q86KR9-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Analysis of Skp1 glycosylation and nuclear enrichment in Dictyostelium.", "journal": "Glycobiology", "date": "2001", "authors": "Sassi S, Sweetinburgh M, Erogul J, Zhang P, Teng-Umnuay P, West C M", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "reference": [ { "type": "PubMed", "id": "11358877", "url": "https://glygen.org/publication/PubMed/11358877" } ] }, { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gloeckner G., Kumpf K., Lehmann R., Platzer M., Rosenthal A., Bankier A.T., Dear P.H., Szafranski K., Guigo R., Parra G., Noegel A.A., Glockner G., Tunggal B., Abril J.F., Cox E., Eichinger L., Quail M.A., Cox E.C., Baumgart C., Pachebat J.A.", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "Cytoplasmic glycosylation of protein-hydroxyproline and its relationship to other glycosylation pathways.", "journal": "Biochim. Biophys. Acta", "date": "2004", "authors": "West C.M., Sassi S., Van Der Wel H., Gaucher E.A.", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "reference": [ { "type": "PubMed", "id": "15238247", "url": "https://glygen.org/publication/PubMed/15238247" } ] }, { "title": "The Skp1 prolyl hydroxylase from Dictyostelium is related to the hypoxia-inducible factor-alpha class of animal prolyl 4-hydroxylases.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "van der Wel Hanke, Ercan Altan, West Christopher M", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "reference": [ { "type": "PubMed", "id": "15705570", "url": "https://glygen.org/publication/PubMed/15705570" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0277759", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277759", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "oxygen metabolic process", "id": "GO:0072592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072592", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "SCF complex assembly", "id": "GO:0010265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010265", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "culmination involved in sorocarp development", "id": "GO:0031154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031154", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ferrous iron binding", "id": "GO:0008198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008198", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "L-ascorbic acid binding", "id": "GO:0031418", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031418", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "peptidyl-proline dioxygenase activity", "id": "GO:0031543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031543", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" }, { "name": "peptidyl-proline 4-dioxygenase activity", "id": "GO:0031545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031545", "evidence": [ { "database": "UniProtKB", "id": "Q86KR9", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "48936", "name": "", "equation": "2-oxoglutarate + L-prolyl-[Skp1 protein] + O2 = CO2 + succinate + trans-4-hydroxy-L-prolyl-[Skp1 protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q86KR9-1" ], "evidence": [ { "id": "48936", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48936" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q86KR9", "gene_name": "phyA", "activity": [ { "ec_number": "1.14.11.-", "activity": "", "evidence": [ { "id": "Q86KR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86KR9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }