{ "uniprot_canonical_ac": "Q86H28-1", "uniprot_ac": "Q86H28", "uniprot_id": "PROD_DICDI", "mass": { "chemical_mass": 65262.0, "monoisotopic_mass": 65262.0 }, "refseq": { "ac": "XP_643510", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643510" }, "gene_names": [ { "name": "prodh", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q86H28", "id": "Q86H28" }, { "name": "DDB_G0275669", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q86H28", "id": "Q86H28" } ], "protein_names": [ { "name": "Proline dehydrogenase 1, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q86H28" }, { "name": "1.5.5.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86H28" }, { "name": "Proline oxidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q86H28" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643510", "id": "XP_643510" } ], "function": [ { "annotation": "Converts proline to delta-1-pyrroline-5-carboxylate.", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "prodh", "url": "https://www.uniprot.org/uniprot/Q86H28", "locus": {} } ], "crossref": [ { "id": "DDB_G0275669", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8620091", "url": "https://www.ncbi.nlm.nih.gov/gene/8620091", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002872", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002872", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015659", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015659", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029041", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029041", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0275669", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0275669", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GPLKKYH", "url": "https://omabrowser.org/oma/group/GPLKKYH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13914", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13914", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13914:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13914:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01619", "url": "http://pfam.xfam.org/family/PF01619", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q86H28", "url": "http://purl.obolibrary.org/obo/PR_Q86H28", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-389661", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-70688", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-70688", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_643510", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643510", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "23784", "url": "https://www.rhea-db.org/rhea/23784", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86H28-1", "url": "https://www.uniprot.org/uniprot/Q86H28-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIKNTVRIINKNSNTFINIRNNNNNNINSSLKSGFGTIKRFNTTLNHNSSNSNIQTPISINSTIINNNNNSNNNNSNNIINNDLNVVKFSTISTPNSILDTLNENHSNQTNNVNNKNYNNNNNNFEKDDKFGPPNNQNNNKLDLDTSKLYVSKSTGELFFTFMILKVCSINFISDNSQKFLNLFEKLGLSKPLNFFIKYSFFKQFCAGETIRETEIFTEKLNKLGIGTILDYAIEELAGSSEGFDSVAENICETIRVAAKNPTNSFSCVKFTGLVTPSVLEKMNTLVSNVTTNVSELPIESFNSPLDFYLNQSSSLMKQGSEPLLTSKDIKEIKEFFNRMDKIFQLCHQRGVPILVDAEQSYYQVAIHHLTMSYSIKYNKEKPIIYNTYQMYLVNGMNVLKQHFELSSSQKFNFKLGAKIVRGAYMVTESERSQRLSTENPVLPTIQDTHKSYNTALDFLLNQIKSDPNSIGLMIASHNEDSINLGTKLIKQYKIDPTNPNIQFGQLFGMADFLSFNLVDQHQRIFKYVPFGPVEEVLPYLIRRMHENKGFIGSNSDKELFYLKKEIKRRLF", "length": 572, "header": "sp|Q86H28-1|PROD_DICDI Isoform 1 of Proline dehydrogenase 1, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=prodh PE=3 SV=1 CANONICAL=Q86H28-1" }, "isoforms": [ { "isoform_ac": "Q86H28-1", "url": "", "sequence": { "sequence": "MIKNTVRIINKNSNTFINIRNNNNNNINSSLKSGFGTIKRFNTTLNHNSSNSNIQTPISINSTIINNNNNSNNNNSNNIINNDLNVVKFSTISTPNSILDTLNENHSNQTNNVNNKNYNNNNNNFEKDDKFGPPNNQNNNKLDLDTSKLYVSKSTGELFFTFMILKVCSINFISDNSQKFLNLFEKLGLSKPLNFFIKYSFFKQFCAGETIRETEIFTEKLNKLGIGTILDYAIEELAGSSEGFDSVAENICETIRVAAKNPTNSFSCVKFTGLVTPSVLEKMNTLVSNVTTNVSELPIESFNSPLDFYLNQSSSLMKQGSEPLLTSKDIKEIKEFFNRMDKIFQLCHQRGVPILVDAEQSYYQVAIHHLTMSYSIKYNKEKPIIYNTYQMYLVNGMNVLKQHFELSSSQKFNFKLGAKIVRGAYMVTESERSQRLSTENPVLPTIQDTHKSYNTALDFLLNQIKSDPNSIGLMIASHNEDSINLGTKLIKQYKIDPTNPNIQFGQLFGMADFLSFNLVDQHQRIFKYVPFGPVEEVLPYLIRRMHENKGFIGSNSDKELFYLKKEIKRRLF", "length": 572, "header": "sp|Q86H28-1|PROD_DICDI Isoform 1 of Proline dehydrogenase 1, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=prodh PE=3 SV=1 CANONICAL=Q86H28-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gloeckner G., Kumpf K., Lehmann R., Platzer M., Rosenthal A., Bankier A.T., Dear P.H., Szafranski K., Guigo R., Parra G., Noegel A.A., Glockner G., Tunggal B., Abril J.F., Cox E., Eichinger L., Quail M.A., Cox E.C., Baumgart C., Pachebat J.A.", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0275669", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0275669", "resource": "KEGG Pathway" }, { "id": "R-DDI-389661", "name": "Glyoxylate metabolism and glycine degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-389661", "resource": "Reactome", "description": "Glyoxylate metabolism and glycine degradation" }, { "id": "R-DDI-70688", "name": "Proline catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-70688", "resource": "Reactome", "description": "Proline catabolism" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "FAD binding", "id": "GO:0071949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071949", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "pmid": "" }, { "name": "proline dehydrogenase activity", "id": "GO:0004657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004657", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proline catabolic process to glutamate", "id": "GO:0010133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010133", "evidence": [ { "database": "UniProtKB", "id": "Q86H28", "url": "https://www.uniprot.org/uniprot/Q86H28" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 105, "end_pos": 107, "annotation": "n_glycosylation_sequon" }, { "start_pos": 108, "end_pos": 110, "annotation": "n_glycosylation_sequon" }, { "start_pos": 289, "end_pos": 291, "annotation": "n_glycosylation_sequon" }, { "start_pos": 28, "end_pos": 30, "annotation": "n_glycosylation_sequon" }, { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 311, "end_pos": 313, "annotation": "n_glycosylation_sequon" }, { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" }, { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" }, { "start_pos": 74, "end_pos": 76, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "23784", "name": "", "equation": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q2V057-1", "F1MAR6-1", "Q9UF12-1", "O43272-4", "Q8VCZ9-1", "Q9WU79-1", "P09368-1", "Q86H28-1", "Q04499-1" ], "evidence": [ { "id": "23784", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23784" } ] }, { "id": "R-DDI-6784224", "name": "PRODH2:FAD dimer dehydrogenates HPRO to 1-pyrroline-3-hydroxy-5-carboxylate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [], "output_participant_list": [ "R-ALL-6784241" ], "enzyme_list": [ "Q86H28-1" ], "evidence": [ { "id": "R-DDI-6784224", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6784224" } ] }, { "id": "R-DDI-70670", "name": "PRODH oxidises L-Pro to 1PYR-5COOH", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [ "R-ALL-113597" ], "output_participant_list": [ "R-ALL-164934" ], "enzyme_list": [ "Q86H28-1" ], "evidence": [ { "id": "R-DDI-70670", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-70670" } ] }, { "id": "R-DDI-8955817", "name": "PRODH2 oxidises HPRO to 1PYR-5COOH", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [ "R-ALL-6784215" ], "output_participant_list": [], "enzyme_list": [ "Q86H28-1" ], "evidence": [ { "id": "R-DDI-8955817", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-8955817" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-113597", "participant_name": "FAD [mitochondrial inner membrane]", "crossref": [ { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "57692", "database": "ChEBI", "url": "" }, { "id": "000195756838", "database": "ZINC", "url": "" }, { "id": "C00016", "database": "COMPOUND", "url": "" }, { "id": "000008215434", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-164934", "participant_name": "FADH2 [mitochondrial inner membrane]", "crossref": [ { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" }, { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" }, { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" }, { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" }, { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "C01352", "database": "COMPOUND", "url": "" }, { "id": "58307", "database": "ChEBI", "url": "" }, { "id": "000095099885", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-6784215", "participant_name": "HPRO [mitochondrial matrix]", "crossref": [ { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" }, { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "58419", "database": "ChEBI", "url": "" }, { "id": "000000901791", "database": "ZINC", "url": "" }, { "id": "000000901736", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-6784241", "participant_name": "1-pyrroline-3-hydroxy-5-carboxylate [mitochondrial matrix]", "crossref": [ { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" }, { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" }, { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" }, { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "58509", "database": "ChEBI", "url": "" }, { "id": "000003870185", "database": "ZINC", "url": "" }, { "id": "000001529908", "database": "ZINC", "url": "" }, { "id": "000003870184", "database": "ZINC", "url": "" }, { "id": "000001529905", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "F1MAR6", "gene_name": "Prodh", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "F1MAR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1MAR6" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "F1MAR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1MAR6" } ] } ] }, { "uniprot_ac": "O43272", "gene_name": "PRODH", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "O43272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43272" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "O43272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43272" } ] } ] }, { "uniprot_ac": "P09368", "gene_name": "PUT1", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "P09368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09368" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "P09368", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09368" } ] } ] }, { "uniprot_ac": "Q04499", "gene_name": "slgA", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q04499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04499" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q04499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04499" } ] } ] }, { "uniprot_ac": "Q2V057", "gene_name": "Prodh2", "activity": [ { "ec_number": "1.5.5.3", "activity": "a quinone + trans-4-hydroxy-L-proline = (3R,5S)-1-pyrroline-3-hydroxy-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q2V057", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2V057" } ] }, { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q2V057", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2V057" } ] }, { "ec_number": "1.5.5.3", "activity": "", "evidence": [ { "id": "Q2V057", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2V057" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q2V057", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2V057" } ] } ] }, { "uniprot_ac": "Q86H28", "gene_name": "prodh", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q86H28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86H28" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q86H28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86H28" } ] } ] }, { "uniprot_ac": "Q8VCZ9", "gene_name": "Prodh2", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q8VCZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCZ9" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q8VCZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCZ9" } ] }, { "ec_number": "1.5.5.3", "activity": "a quinone + trans-4-hydroxy-L-proline = (3R,5S)-1-pyrroline-3-hydroxy-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q8VCZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCZ9" } ] }, { "ec_number": "1.5.5.3", "activity": "", "evidence": [ { "id": "Q8VCZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCZ9" } ] } ] }, { "uniprot_ac": "Q9UF12", "gene_name": "PRODH2", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q9UF12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UF12" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q9UF12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UF12" } ] }, { "ec_number": "1.5.5.3", "activity": "a quinone + trans-4-hydroxy-L-proline = (3R,5S)-1-pyrroline-3-hydroxy-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q9UF12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UF12" } ] }, { "ec_number": "1.5.5.3", "activity": "", "evidence": [ { "id": "Q9UF12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UF12" } ] } ] }, { "uniprot_ac": "Q9WU79", "gene_name": "Prodh", "activity": [ { "ec_number": "1.5.5.2", "activity": "a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+).", "evidence": [ { "id": "Q9WU79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WU79" } ] }, { "ec_number": "1.5.5.2", "activity": "", "evidence": [ { "id": "Q9WU79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WU79" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }