{ "uniprot_canonical_ac": "Q811S7-1", "uniprot_ac": "Q811S7", "uniprot_id": "UBIP1_MOUSE", "mass": { "chemical_mass": 60212.0, "monoisotopic_mass": 60212.0 }, "refseq": { "ac": "NP_001076788", "name": "upstream-binding protein 1 isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788" }, "gene_names": [ { "name": "Ubp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q811S7", "id": "Q811S7" }, { "name": "Cp2b; LBP-1a; LBP-1b; NF2d9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788", "id": "NP_001076788" }, { "name": "Cp2b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q811S7", "id": "Q811S7" }, { "name": "Nf2d9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q811S7", "id": "Q811S7" }, { "name": "Ubp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788", "id": "NP_001076788" } ], "protein_names": [ { "name": "Upstream-binding protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q811S7" }, { "name": "NF2d9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q811S7" }, { "name": "Nuclear factor 2d9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q811S7" }, { "name": "nuclear factor 2d9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788", "id": "NP_001076788" }, { "name": "upstream-binding protein 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788", "id": "NP_001076788" } ], "function": [ { "annotation": "Functions as a transcriptional activator in a promoter context-dependent manner. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2. Functions as a trans-acting factor that regulates the domestic strain CYP2D9 gene through specific association with the regulatory element SDI-A1. Binding to SDI-A1 depends on the type of nucleotide at position 299; binding is abolished by a nucleotide substitution at this position. Modulates the placental expression of CYP11A1 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7#function" }, { "database": "PubMed", "id": "7623810", "url": "https://glygen.org/publication/PubMed/7623810" }, { "database": "PubMed", "id": "15988015", "url": "https://glygen.org/publication/PubMed/15988015" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ubp1", "url": "https://www.uniprot.org/uniprot/Q811S7", "locus": { "chromosome": "9", "start_pos": 113806270, "end_pos": 113760002, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000009741", "url": "https://www.ensembl.org/id/ENSMUSG00000009741" } ] } } ], "crossref": [ { "id": "ENSMUSG00000009741", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000009741", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd09588", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09588", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22221", "url": "https://www.ncbi.nlm.nih.gov/gene/22221", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q811S7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q811S7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007604", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007604", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013761", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013761", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037600", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037600", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040167", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040167", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041418", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041418", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22221", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22221", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "104889", "url": "http://www.informatics.jax.org/marker/MGI:104889", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "INHVYRQ", "url": "https://omabrowser.org/oma/group/INHVYRQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1363858at2759", "url": "http://www.orthodb.org/?query=1363858at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11037", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11037", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11037:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11037:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04516", "url": "http://pfam.xfam.org/family/PF04516", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18016", "url": "http://pfam.xfam.org/family/PF18016", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q811S7", "url": "http://purl.obolibrary.org/obo/PR_Q811S7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001076788", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001076788", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q811S7-1", "url": "https://www.uniprot.org/uniprot/Q811S7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q811S7-2", "url": "https://www.uniprot.org/uniprot/Q811S7-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEDEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPELSGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDTPTAYVNNSPSPAPTFTSSQPSTCSVPDSNSSSPNHQGDGAAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSTALQGQPQAAGSGGESGGGTPSVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDETCFLFSTVKAENNDGIHIILK", "length": 540, "header": "sp|Q811S7-1|UBIP1_MOUSE Isoform 1 of Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1 CANONICAL=Q811S7-1" }, "isoforms": [ { "isoform_ac": "Q811S7-1", "url": "", "sequence": { "sequence": "MAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEDEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPELSGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDTPTAYVNNSPSPAPTFTSSQPSTCSVPDSNSSSPNHQGDGAAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSTALQGQPQAAGSGGESGGGTPSVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDETCFLFSTVKAENNDGIHIILK", "length": 540, "header": "sp|Q811S7-1|UBIP1_MOUSE Isoform 1 of Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1 CANONICAL=Q811S7-1" }, "locus": { "chromosome": "9", "start_pos": 113804448, "end_pos": 113760722, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000084885", "url": "https://www.ensembl.org/id/ENSMUST00000084885" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000081946", "url": "https://www.ensembl.org/id/ENSMUSP00000081946" } ] } }, { "isoform_ac": "Q811S7-2", "url": "", "sequence": { "sequence": "MAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEDEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPELSGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTECSPWPDTPTAYVNNSPSPAPTFTSSQPSTCSVPDSNSSSPNHQGDGAAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSTALQGQPQAAGSGGESGGGTPSVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDETCFLFSTVKAENNDGIHIILK", "length": 504, "header": "sp|Q811S7-2|UBIP1_MOUSE Isoform 2 of Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1 CANONICAL=Q811S7-1" }, "locus": { "chromosome": "9", "start_pos": 113804448, "end_pos": 113760722, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000009885", "url": "https://www.ensembl.org/id/ENSMUST00000009885" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000009885", "url": "https://www.ensembl.org/id/ENSMUSP00000009885" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "site_lbl": "Ser22" }, { "start_pos": 390, "end_pos": 390, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q811S7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q811S7" } ], "site_lbl": "Ser390" }, { "start_pos": 393, "end_pos": 393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q811S7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q811S7" } ], "site_lbl": "Ser393" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Erythroid cell-specific alpha-globin gene regulation by the CP2 transcription factor family.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Cho Y.S., Kim S.-H., Lee Y.H., Kang H.C., Kim C.G., Shin J.H., Chae J.H., Fiering S., Park M.-A., Ye S.-K.", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "reference": [ { "type": "PubMed", "id": "15988015", "url": "https://glygen.org/publication/PubMed/15988015" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" }, { "database": "iPTMnet", "id": "Q811S7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q811S7" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "A nuclear factor (NF2d9) that binds to the male-specific P450 (Cyp 2d-9) gene in mouse liver.", "journal": "Mol. Cell. Biol.", "date": "1995", "authors": "Sueyoshi T, Kobayashi R, Nishio K, Aida K, Moore R, Wada T, Handa H, Negishi M", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "reference": [ { "type": "PubMed", "id": "7623810", "url": "https://glygen.org/publication/PubMed/7623810" } ] } ], "pathway": [ { "id": "mmu:22221", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22221", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6GFC7-1", "protein_name": "Upstream binding protein 1", "gene_name": "Ubp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRRGAGGRGRAARLAARSLPLQLLAGTLCPDSWASAALVSAASRAAAGDHSPRRRRLHPRPPSGRARGARAPSPRTRRPRCAGRRRGRKMAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEAEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDVPEISGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDTPTAYVNNSPSPAPTFTSSQQSTCSVPDSNSSSPNHQGDGVAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSAVPQGQPQAAGSGGEGGAGTPCVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAENNDGIHIILK", "length": 629 }, "evidence": [ { "id": "45234016", "url": "http://www.informatics.jax.org/homology/45234016", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NZI7-1", "protein_name": "Upstream-binding protein 1", "gene_name": "UBP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGAPYVYHAIYLEEMIASEVARKLALVFNIPLHQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAESSDGIHIILK", "length": 540 }, "evidence": [ { "id": "45234016", "url": "http://www.informatics.jax.org/homology/45234016", "database": "MGI" }, { "id": "Q811S7", "url": "https://omabrowser.org/oma/group/Q811S7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "negative regulation of viral transcription", "id": "GO:0032897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032897", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "Q811S7", "url": "https://www.uniprot.org/uniprot/Q811S7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 322, "end_pos": 324, "annotation": "n_glycosylation_sequon" }, { "start_pos": 345, "end_pos": 347, "annotation": "n_glycosylation_sequon" }, { "start_pos": 391, "end_pos": 393, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }