{ "uniprot_canonical_ac": "Q80ZD7-1", "uniprot_ac": "Q80ZD7", "uniprot_id": "AMGO1_RAT", "mass": { "chemical_mass": 55283.0, "monoisotopic_mass": 55283.0 }, "refseq": { "ac": "NP_996764", "name": "amphoterin-induced protein 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764" }, "gene_names": [ { "name": "Amigo1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80ZD7", "id": "Q80ZD7" }, { "name": "Ali2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q80ZD7", "id": "Q80ZD7" }, { "name": "Amigo1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764", "id": "NP_996764" }, { "name": "Amigo", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764", "id": "NP_996764" }, { "name": "Amigo", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q80ZD7", "id": "Q80ZD7" } ], "protein_names": [ { "name": "Amphoterin-induced protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q80ZD7" }, { "name": "AMIGO-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80ZD7" }, { "name": "Alivin-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80ZD7" }, { "name": "amphoterin-induced protein 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764", "id": "NP_996764" }, { "name": "amphoterin-induced protein 1; AMIGO-1; alivin-2; amphoretin-induced gene and ORF; transmembrane protein AMIGO", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764", "id": "NP_996764" } ], "function": [ { "annotation": "AMIGO is a function-modulating auxiliary subunit for Kv2.1. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_996764", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764" }, { "database": "PubMed", "id": "22056818", "url": "https://glygen.org/publication/PubMed/22056818" } ] }, { "annotation": "Data show that AMIGO is a glycosylated protein widely expressed in the central nervous system (CNS), and can be found in neurons, astrocytes as well as oligodendrocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_996764", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764" }, { "database": "PubMed", "id": "21938721", "url": "https://glygen.org/publication/PubMed/21938721" } ] }, { "annotation": "Promotes growth and fasciculation of neurites from cultured hippocampal neurons. May be involved in fasciculation as well as myelination of developing neural axons. May have a role in regeneration as well as neural plasticity in the adult nervous system. May mediate homophilic as well as heterophilic cell-cell interaction and contribute to signal transduction through its intracellular domain (PubMed:12629050). Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7#function" }, { "database": "PubMed", "id": "12629050", "url": "https://glygen.org/publication/PubMed/12629050" }, { "database": "UniProtKB", "id": "Q80ZD8", "url": "https://www.uniprot.org/uniprot/Q80ZD8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Amigo1", "url": "https://www.uniprot.org/uniprot/Q80ZD7", "locus": { "chromosome": "2", "start_pos": 195829585, "end_pos": 195823042, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000045665", "url": "https://www.ensembl.org/id/ENSRNOG00000045665" } ] } } ], "crossref": [ { "id": "ENSRNOG00000045665", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000045665", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "295365", "url": "https://www.ncbi.nlm.nih.gov/gene/295365", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q80ZD7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q80ZD7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000483", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000483", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003591", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003591", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013098", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013098", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031283", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031283", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:295365", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:295365", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VFSDTPM", "url": "https://omabrowser.org/oma/group/VFSDTPM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3472064at2759", "url": "http://www.orthodb.org/?query=3472064at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24368", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24368", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24368:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24368:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07679", "url": "http://pfam.xfam.org/family/PF07679", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13855", "url": "http://pfam.xfam.org/family/PF13855", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q80ZD7", "url": "http://purl.obolibrary.org/obo/PR_Q80ZD7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_996764", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1303079", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303079", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80ZD7-1", "url": "https://www.uniprot.org/uniprot/Q80ZD7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQPQRDLRGLWLLLLSLFLLLFEVARAGRPVVSCPANCLCASNILSCSKQQLPNVPQSLPGYTALLDLSHNNLSRLKAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSGLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNMISRFPLELIKDANRLPKLTLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCVHSKKLHNVFSLDFFNCSEYKESAWEAHLGDTLTITCDTKQQGMTKVWVTPSNEQVLNQGANGTVTVSEDGNLHFKEVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV", "length": 493, "header": "sp|Q80ZD7-1|AMGO1_RAT Isoform 1 of Amphoterin-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Amigo1 PE=1 SV=1 CANONICAL=Q80ZD7-1" }, "isoforms": [ { "isoform_ac": "Q80ZD7-1", "url": "", "sequence": { "sequence": "MQPQRDLRGLWLLLLSLFLLLFEVARAGRPVVSCPANCLCASNILSCSKQQLPNVPQSLPGYTALLDLSHNNLSRLKAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSGLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNMISRFPLELIKDANRLPKLTLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCVHSKKLHNVFSLDFFNCSEYKESAWEAHLGDTLTITCDTKQQGMTKVWVTPSNEQVLNQGANGTVTVSEDGNLHFKEVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV", "length": 493, "header": "sp|Q80ZD7-1|AMGO1_RAT Isoform 1 of Amphoterin-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Amigo1 PE=1 SV=1 CANONICAL=Q80ZD7-1" }, "locus": { "chromosome": "2", "start_pos": 195825473, "end_pos": 195823995, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000074725", "url": "https://www.ensembl.org/id/ENSRNOT00000074725" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066608", "url": "https://www.ensembl.org/id/ENSRNOP00000066608" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "Q80ZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZD7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 315, "start_aa": "Asn", "end_pos": 315, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn315", "evidence": [ { "id": "Q80ZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZD7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 349, "start_aa": "Asn", "end_pos": 349, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn349", "evidence": [ { "id": "Q80ZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZD7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "Q80ZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZD7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "Q80ZD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZD7#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 477, "end_pos": 477, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q80ZD7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q80ZD7" } ], "site_lbl": "Ser477" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "site_lbl": "Ser481" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "AMIGO, a transmembrane protein implicated in axon tract development, defines a novel protein family with leucine-rich repeats.", "journal": "J. Cell Biol.", "date": "2003", "authors": "Kiiltomaeki M., Kuja-Panula J., Rauvala H., Rouhiainen A., Yamashiro T.", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "reference": [ { "type": "PubMed", "id": "12629050", "url": "https://glygen.org/publication/PubMed/12629050" } ] }, { "title": "AMIGO is expressed in multiple brain cell types and may regulate dendritic growth and neuronal survival.", "journal": "Journal of cellular physiology", "date": "2012", "authors": "Chen Y, Hor HH, Tang BL", "evidence": [ { "database": "RefSeq", "id": "NP_996764", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764" } ], "reference": [ { "type": "PubMed", "id": "21938721", "url": "https://glygen.org/publication/PubMed/21938721" } ] }, { "title": "AMIGO is an auxiliary subunit of the Kv2.1 potassium channel.", "journal": "EMBO reports", "date": "2011", "authors": "Peltola MA, Kuja-Panula J, Lauri SE, Taira T, Rauvala H", "evidence": [ { "database": "RefSeq", "id": "NP_996764", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996764" } ], "reference": [ { "type": "PubMed", "id": "22056818", "url": "https://glygen.org/publication/PubMed/22056818" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" }, { "database": "iPTMnet", "id": "Q80ZD7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q80ZD7" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:295365", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:295365", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q80ZD8-1", "protein_name": "Amphoterin-induced protein 1", "gene_name": "Amigo1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQPQRDLRGLWLLLLSVFLLLFEVARAGRSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV", "length": 492 }, "evidence": [ { "id": "45233972", "url": "http://www.informatics.jax.org/homology/45233972", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q86WK6-1", "protein_name": "Amphoterin-induced protein 1", "gene_name": "AMIGO1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV", "length": 493 }, "evidence": [ { "id": "45233972", "url": "http://www.informatics.jax.org/homology/45233972", "database": "MGI" }, { "id": "Q80ZD7", "url": "https://omabrowser.org/oma/group/Q80ZD7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "voltage-gated potassium channel complex", "id": "GO:0008076", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008076", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "neuronal cell body membrane", "id": "GO:0032809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032809", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "pericellular basket", "id": "GO:1990030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990030", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "myelination", "id": "GO:0042552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042552", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "positive regulation of synapse assembly", "id": "GO:0051965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051965", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "positive regulation of voltage-gated potassium channel activity", "id": "GO:1903818", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903818", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "homophilic cell adhesion via plasma membrane adhesion molecules", "id": "GO:0007156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007156", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules", "id": "GO:0007157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007157", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "axonal fasciculation", "id": "GO:0007413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007413", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "positive regulation of axonogenesis", "id": "GO:0050772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050772", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "positive regulation of potassium ion transmembrane transport", "id": "GO:1901381", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901381", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "neuron projection fasciculation", "id": "GO:0106030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106030", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" }, { "name": "cellular response to L-glutamate", "id": "GO:1905232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905232", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "potassium channel regulator activity", "id": "GO:0015459", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015459", "evidence": [ { "database": "UniProtKB", "id": "Q80ZD7", "url": "https://www.uniprot.org/uniprot/Q80ZD7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" }, { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" }, { "start_pos": 349, "end_pos": 351, "annotation": "n_glycosylation_sequon" }, { "start_pos": 360, "end_pos": 362, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }