{ "uniprot_canonical_ac": "Q80YE2-1", "uniprot_ac": "Q80YE2", "uniprot_id": "T53I1_RAT", "mass": { "chemical_mass": 26976.0, "monoisotopic_mass": 26976.0 }, "refseq": { "ac": "NP_851598", "name": "tumor protein p53-inducible nuclear protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598" }, "gene_names": [ { "name": "Tp53inp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80YE2", "id": "Q80YE2" }, { "name": "Trp53inp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80YE2", "id": "Q80YE2" }, { "name": "Sip", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q80YE2", "id": "Q80YE2" }, { "name": "Stinp; Trp53inp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598", "id": "NP_851598" }, { "name": "Tp53inp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598", "id": "NP_851598" } ], "protein_names": [ { "name": "Tumor protein p53-inducible nuclear protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q80YE2" }, { "name": "Stress-induced protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80YE2" }, { "name": "TEAP; p53DINP1; stress-induced protein; thymus-expressed acidic protein; p53-dependent damage-inducible nuclear protein 1; transformation related protein 53 inducible nuclear protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598", "id": "NP_851598" }, { "name": "TEAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80YE2" }, { "name": "Thymus-expressed acidic protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80YE2" }, { "name": "p53-dependent damage-inducible nuclear protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80YE2" }, { "name": "p53DINP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80YE2" }, { "name": "tumor protein p53-inducible nuclear protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598", "id": "NP_851598" } ], "function": [ { "annotation": "Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2#function" } ] }, { "annotation": "IR-induced alterations in hind-limb motor function were closely related to the temporal changes in miR-125b and TP53INP1 expression. The miR-125b/TP53INP1 gene pair was confirmed by luciferase assay.", "evidence": [ { "database": "RefSeq", "id": "NP_851598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598" }, { "database": "PubMed", "id": "30193876", "url": "https://glygen.org/publication/PubMed/30193876" } ] }, { "annotation": "In conclusion, miRNA-221 exerts cytoprotective effects in hypoxia-reoxygenation injury in association with alterations in autophagic cell injury. Mir-221 may constitute is a novel therapeutic target in the treatment of cardiac I/R injury.", "evidence": [ { "database": "RefSeq", "id": "NP_851598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598" }, { "database": "PubMed", "id": "27105917", "url": "https://glygen.org/publication/PubMed/27105917" } ] } ], "disease": [ { "disease_id": "DOID:14221", "recommended_name": { "id": "DOID:14221", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14221", "name": "abdominal obesity-metabolic syndrome 1", "description": "An abdominal obesity-metabolic syndrome characterized by insulin resistance and hyperinsulinemia, dyslipidemia, essential hypertension, abdominal obesity, glucose intolerance or noninsulin-dependent diabetes mellitus and an increased risk of cardiovascular events." }, "synonyms": [ { "id": "DOID:14221", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14221", "name": "dysmetabolic syndrome X", "description": "" }, { "id": "DOID:14221", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14221", "name": "metabolic syndrome X", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "metabolic syndrome X", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "abdominal obesity-metabolic syndrome 1", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "dysmetabolic syndrome X", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "metabolic syndrome type X", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "AOMS1", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "abdominal obesity metabolic syndrome", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "abdominal obesity-metabolic syndrome quantitative trait locus 1", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "metabolic syndrome 10", "description": "" }, { "id": "MONDO:0011565", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011565", "name": "metabolic syndrome, protection against", "description": "" } ], "evidence": [ { "id": "14221", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14221" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Trp53inp1", "url": "https://www.uniprot.org/uniprot/Q80YE2", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000007964", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000007964", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "297822", "url": "https://www.ncbi.nlm.nih.gov/gene/297822", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029431", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029431", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:297822", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297822", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KHSGWVV", "url": "https://omabrowser.org/oma/group/KHSGWVV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5406690at2759", "url": "http://www.orthodb.org/?query=5406690at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31671", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31671", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31671:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31671:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14839", "url": "http://pfam.xfam.org/family/PF14839", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q80YE2", "url": "http://purl.obolibrary.org/obo/PR_Q80YE2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-6804756", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6804756", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_851598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "631423", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=631423", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AHT6", "url": "https://www.uniprot.org/uniprot/A0A8I6AHT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AHT6-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AHT6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V708", "url": "https://www.uniprot.org/uniprot/G3V708", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V708-1", "url": "https://www.uniprot.org/uniprot/G3V708-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80YE2-1", "url": "https://www.uniprot.org/uniprot/Q80YE2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFQRLNKMFVGEVTTSSSHEPEFSEKEDDEWILVDFIDTCTGFSAEEEEEDEDIGEESSAEHTSVFSCLPTSLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDDYNSSGPRMEAQSELGTHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHRCWAVHQPCPRQYNY", "length": 239, "header": "sp|Q80YE2-1|T53I1_RAT Isoform 1 of Tumor protein p53-inducible nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Trp53inp1 PE=2 SV=1 CANONICAL=Q80YE2-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AHT6-1", "url": "", "sequence": { "sequence": "MFQRLNKMFVGEVTTSSSHEPEFSEKEDDEWILVDFIDTCTGFSAEEEEEDEDIGEESSAEHTSVFSCLPTSLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDDYNSSGPRYAASTSLCLSDLLSKSFISTQNTAKALEDMKLSVLEMYLSNLGYKCNIQVKIAFYKVINCSMAQLYNSHFVYKIMLLMGNKKTSISDKYIRM", "length": 249, "header": "tr|A0A8I6AHT6-1|A0A8I6AHT6_RAT Computationally mapped isoform of Tumor protein p53 inducible nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53inp1 PE=4 SV=1 CANONICAL=Q80YE2-1" }, "locus": { "chromosome": "5", "start_pos": 24263324, "end_pos": 24262066, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000116994.1", "url": "https://www.ensembl.org/id/ENSRNOT00000116994.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000092415.1", "url": "https://www.ensembl.org/id/ENSRNOP00000092415.1" } ] } }, { "isoform_ac": "G3V708-1", "url": "", "sequence": { "sequence": "MFQRLNKMFVGEVTTSSSHEPEFSEKEDDEWILVDFIDTCTGFSAEEEEEDEDIGEESSAEHTSVFSCLPTSLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDDYNSSGPRMEAQSELGTHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDYHTRQMKHSGWVVHQPCPRQYNY", "length": 239, "header": "tr|G3V708-1|G3V708_RAT Computationally mapped isoform of Tumor protein p53 inducible nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53inp1 PE=4 SV=1 CANONICAL=Q80YE2-1" }, "locus": { "chromosome": "5", "start_pos": 24267792, "end_pos": 24262066, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000010591.5", "url": "https://www.ensembl.org/id/ENSRNOT00000010591.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000010591.2", "url": "https://www.ensembl.org/id/ENSRNOP00000010591.2" } ] } }, { "isoform_ac": "Q80YE2-1", "url": "", "sequence": { "sequence": "MFQRLNKMFVGEVTTSSSHEPEFSEKEDDEWILVDFIDTCTGFSAEEEEEDEDIGEESSAEHTSVFSCLPTSLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDDYNSSGPRMEAQSELGTHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHRCWAVHQPCPRQYNY", "length": 239, "header": "sp|Q80YE2-1|T53I1_RAT Isoform 1 of Tumor protein p53-inducible nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Trp53inp1 PE=2 SV=1 CANONICAL=Q80YE2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Tumor protein p53-induced nuclear protein 1 (TP53INP1) in spontaneous chronic pancreatitis in the WBN/Kob rat: drug effects on its expression in the pancreas.", "journal": "J. Pancreas", "date": "2004", "authors": "Iovanna J.L., Pebusque M.-J., Jiang P.-H., Motoo Y., Okada G., Sawabu N., Xie M.-J.", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "reference": [ { "type": "PubMed", "id": "15254349", "url": "https://glygen.org/publication/PubMed/15254349" } ] }, { "title": "Up-regulation of miRNA-221 inhibits hypoxia/reoxygenation-induced autophagy through the DDIT4/mTORC1 and Tp53inp1/p62 pathways.", "journal": "Biochemical and biophysical research communications", "date": "2016", "authors": "Chen Q, Zhou Y, Richards AM, Wang P", "evidence": [ { "database": "RefSeq", "id": "NP_851598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598" } ], "reference": [ { "type": "PubMed", "id": "27105917", "url": "https://glygen.org/publication/PubMed/27105917" } ] }, { "title": "MicroRNA-125b mimic inhibits ischemia reperfusion-induced neuroinflammation and aberrant p53 apoptotic signalling activation through targeting TP53INP1.", "journal": "Brain, behavior, and immunity", "date": "2018", "authors": "Li XQ, Yu Q, Tan WF, Zhang ZL, Ma H", "evidence": [ { "database": "RefSeq", "id": "NP_851598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_851598" } ], "reference": [ { "type": "PubMed", "id": "30193876", "url": "https://glygen.org/publication/PubMed/30193876" } ] } ], "pathway": [ { "id": "rno:297822", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297822", "resource": "KEGG Pathway" }, { "id": "R-RNO-6804756", "name": "Regulation of TP53 Activity through Phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6804756", "resource": "Reactome", "description": "Regulation of TP53 Activity through Phosphorylation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY", "length": 240 }, "evidence": [ { "id": "45230238", "url": "http://www.informatics.jax.org/homology/45230238", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9QXE4-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "Trp53inp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFQRLNKMFVGEVTTSSSQEPEFSEKEDDEWILVDFIDTCPGFSAEEEEEDEDIGEESSAEHTSVFSCLPASLECLTDTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEASCGNDEYNSSGPRMEAQSEMGKHIHCCVAALAAQATFLEQPKSFRPSQWIKGHSERQSLNRNGLRRQNLTRDCHTRQMKHSGWVVHQPCPRQYNY", "length": 239 }, "evidence": [ { "id": "45230238", "url": "http://www.informatics.jax.org/homology/45230238", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 17, "go_terms": [ { "name": "negative regulation of myofibroblast differentiation", "id": "GO:1904761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904761", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "autophagosome assembly", "id": "GO:0000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000045", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "negative regulation of cell migration", "id": "GO:0030336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030336", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cellular response to ethanol", "id": "GO:0071361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071361", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "negative regulation of fibroblast proliferation", "id": "GO:0048147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048147", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "positive regulation of autophagy", "id": "GO:0010508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010508", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cellular response to hydroperoxide", "id": "GO:0071447", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071447", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cellular response to UV", "id": "GO:0034644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034644", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "autophagic cell death", "id": "GO:0048102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048102", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cellular response to methyl methanesulfonate", "id": "GO:0072703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072703", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "autophagosome", "id": "GO:0005776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005776", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" }, { "name": "PML body", "id": "GO:0016605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016605", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antioxidant activity", "id": "GO:0016209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016209", "evidence": [ { "database": "UniProtKB", "id": "Q80YE2", "url": "https://www.uniprot.org/uniprot/Q80YE2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" }, { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }