{ "uniprot_canonical_ac": "Q80WK7-1", "uniprot_ac": "Q80WK7", "uniprot_id": "S29A3_RAT", "mass": { "chemical_mass": 51677.0, "monoisotopic_mass": 51677.0 }, "refseq": { "ac": "NP_853670", "name": "equilibrative nucleoside transporter 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670" }, "gene_names": [ { "name": "Slc29a3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80WK7", "id": "Q80WK7" }, { "name": "Ent3; rENT3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670", "id": "NP_853670" }, { "name": "Ent3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q80WK7", "id": "Q80WK7" }, { "name": "Slc29a3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670", "id": "NP_853670" } ], "protein_names": [ { "name": "Equilibrative nucleoside transporter 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q80WK7" }, { "name": "Solute carrier family 29 member 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80WK7" }, { "name": "equilibrative nucleoside transporter 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670", "id": "NP_853670" }, { "name": "rENT3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80WK7" }, { "name": "solute carrier family 29 (nucleoside transporters), member 3; solute carrier family 29 (equilibrative nucleoside transporter), member 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670", "id": "NP_853670" } ], "function": [ { "annotation": "Uniporter that mediates the facilitative transport of nucleoside across lysosomal and mitochondrial membranes. Functions as a non-electrogenic Na(+)-independent transporter. Substrate transport is pH-dependent and enhanced under acidic condition, probably reflecting the location of the transporter in acidic intracellular compartments. Proton is not a cotransporting ion but most likely change the ionization state of the transporter which dictates transport-permissible/impermissible conformation for nucleoside translocation. May direct the nucleoside transport from lysosomes to cytosol or cytosol to mitochondria to facilitate the fundamental function of salvage synthesis of nucleic acids. Involved in the transport of nucleosides (adenosine, guanosine, uridine, thymidine, cytidine and inosine) and deoxynucleosides (deoxyadenosine, deoxycytidine). Also mediates transport of purine nucleobases (adenine, guanine) and pyrimidine nucleobases (uracil). Also able to transport monoamine neurotransmitters dopamine, serotonin, noradrenaline and tyramine. Capable of transporting ATP (By similarity). Mediates nucleoside export from lysosomes in macrophages, which regulates macrophage functions and numbers (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7#function" }, { "database": "UniProtKB", "id": "Q99P65", "url": "https://www.uniprot.org/uniprot/Q99P65#function" }, { "database": "UniProtKB", "id": "Q9BZD2", "url": "https://www.uniprot.org/uniprot/Q9BZD2#function" } ] } ], "disease": [ { "disease_id": "DOID:0111278", "recommended_name": { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "histiocytosis-lymphadenopathy plus syndrome", "description": "A syndrome characterized by histiocytosis, hyperpigmentation, hypertrichosis, hepatosplenomegaly, heart anomalies, hearing loss, hypogonadism, and reduced height that has_material_basis_in homozygous or compound heterozygous mutation in SLC29A3 on 10q22.1. This syndrome comprises features from 4 histiocytic disorders that were previously considered distinct: Faisalabad histiocytosis, sinus histiocytosis with massive lymphadenopathy, H syndrome, and pigmented hypertrichosis with insulin-dependent diabetes mellitus syndrome." }, "synonyms": [ { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "Faisalabad histiocytosis", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "H syndrome", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "HJCD", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "PHID", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "SHML", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "familial Rosai-Dorfman disease", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "pigmented hypertrichosis with insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "sinus histiocytosis and massive lymphadenopathy", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "cutaneous hyperpigmentation with hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism with or without hearing loss", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "histiocytosis and lymphadenopathy with or without cutaneous, cardiac, and/or endocrine features, joint contractures and/or deafness", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "histiocytosis with joint contractures and sensorineural deafness", "description": "" }, { "id": "DOID:0111278", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111278", "name": "RosaiDorfman disease", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "H syndrome", "description": "A systemic inherited histiocytosis, with characteristic cutaneous findings accompanying systemic manifestations. H syndrome refers to the major clinical findings of hyperpigmentation, hypertrichosis, hepatosplenomegaly, heart anomalies, hearing loss, hypogonadism, low height, and occasionally, hyperglycemia/diabetes mellitus. Due to overlapping clinical features, H syndrome is now considered to include pigmented hypertrichosis with insulin dependent diabetes mellitus syndrome (PHID), Faisalabad histiocytosis (FHC) and familial sinus histiocytosis with massive lymphadenopathy (FSHML)." }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "Asrar Facharzt Haque syndrome", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "H syndrome", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "Faisalabad histiocytosis", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "HJCD", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "Rosai-Dorfman disease, familial", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "SLC29A3 spectrum disorder", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "histiocytosis and lymphadenopathy with or without cutaneous, Cardiac, and/or endocrine features, Joint contractures, and/or deafness", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "histiocytosis with Joint contractures and sensorineural deafness", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "histiocytosis-lymphadenopathy plus syndrome", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "hyperpigmentation, cutaneous, with hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism with or without hearing loss", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "pigmented hypertrichosis with insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0011273", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011273", "name": "sinus histiocytosis and massive lymphadenopathy", "description": "" }, { "id": "MIM:602782", "resource": "MIM", "url": "https://www.omim.org/entry/602782", "name": "Histiocytosis-lymphadenopathy plus syndrome", "description": "Histiocytosis-lymphadenopathy plus syndrome" } ], "evidence": [ { "id": "0111278", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111278" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Slc29a3", "url": "https://www.uniprot.org/uniprot/Q80WK7", "locus": { "chromosome": "20", "start_pos": 28647391, "end_pos": 28685388, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000000568", "url": "https://www.ensembl.org/id/ENSRNOG00000000568" } ] } } ], "crossref": [ { "id": "ENSRNOG00000000568", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000000568", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "353307", "url": "https://www.ncbi.nlm.nih.gov/gene/353307", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:353307", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:353307", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GSPWTTK", "url": "https://omabrowser.org/oma/group/GSPWTTK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "517168at2759", "url": "http://www.orthodb.org/?query=517168at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10332", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10332", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10332:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10332:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01733", "url": "http://pfam.xfam.org/family/PF01733", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q80WK7", "url": "http://purl.obolibrary.org/obo/PR_Q80WK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-83936", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-83936", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9755088", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9755088", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_853670", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_853670", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "727811", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=727811", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "69404", "url": "https://www.rhea-db.org/rhea/69404", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71519", "url": "https://www.rhea-db.org/rhea/71519", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71531", "url": "https://www.rhea-db.org/rhea/71531", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73863", "url": "https://www.rhea-db.org/rhea/73863", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73867", "url": "https://www.rhea-db.org/rhea/73867", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73871", "url": "https://www.rhea-db.org/rhea/73871", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "74783", "url": "https://www.rhea-db.org/rhea/74783", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75343", "url": "https://www.rhea-db.org/rhea/75343", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75363", "url": "https://www.rhea-db.org/rhea/75363", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75367", "url": "https://www.rhea-db.org/rhea/75367", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75371", "url": "https://www.rhea-db.org/rhea/75371", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75375", "url": "https://www.rhea-db.org/rhea/75375", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75687", "url": "https://www.rhea-db.org/rhea/75687", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75691", "url": "https://www.rhea-db.org/rhea/75691", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "75695", "url": "https://www.rhea-db.org/rhea/75695", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6GLJ6", "url": "https://www.uniprot.org/uniprot/A0A8I6GLJ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GLJ6-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GLJ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q0D9", "url": "https://www.uniprot.org/uniprot/A0A8L2Q0D9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q0D9-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q0D9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80WK7-1", "url": "https://www.uniprot.org/uniprot/Q80WK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAFASEDIAYHSSNAVYRVPSNRHEADQEALLGKPLDYPAPGLQRPEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAFKLRNCSSPASGKDPEDADILNYFESYLAVASTVPSLLFLVANFLLVNRIRVHVRVLASLSVSLAIFVVMAVLVRVDTSSWTRGFFSIAMACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVASLVDLAASSDVRDSALAFFLTAAVFLGLCVGLYLLLPQLEYARYYMRPVVPIHVFSSEDSPPRDAPSTSSVAPASRAVHTPPLGPILKKTAGLGFCAVFLYFITALIFPAISTNIQPMHKGTGSPWTSKFYVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPILAVSRVCLVPLFLLCNYQPRSHLTLVLFQSDIYPILFTCLLGLSNGYLSTLVLMYGPKIVPRELAEATSVVMLFYMSLGLMLGSACAALLEHFI", "length": 475, "header": "sp|Q80WK7-1|S29A3_RAT Isoform 1 of Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=2 CANONICAL=Q80WK7-1" }, "isoforms": [ { "isoform_ac": "A0A8I6GLJ6-1", "url": "", "sequence": { "sequence": "MSSRLHQSPALLPAHSPGLSVSLFALTVAFASEDIAYHSSNAVYRVPSNRHEADQEALLGKPLDYPAPGLQRPEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAFKLRNCSSPASGKDPEDADILNYFESYLAVASTVPSLLFLVANFLLVNRIRVHVRVLASLSVSLAIFVVMAVLVRVDTSSWTRGFFSIAMACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVASLVDLAASSDVRDSALAFFLTAAVFLGLCVGLYLLLPQLEYARYYMRPVVPIHVFSSEDSPPRDAPSTSSVAPASRAVHTPPLGPILKKTAGLGFCAVFLYFITALIFPAISTNIQPMHKGTGSPWTSKFYVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPILAVSRVCLVPLFLLCNYQPRSHLTLVLFQSDIYPILFTCLLGLSNGYLSTLVLMYGPKIVPRELAEATSVVMLFYMSLGLMLGSACAALLEHFI", "length": 502, "header": "tr|A0A8I6GLJ6-1|S29A3_RAT Computationally mapped isoform of Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=1 CANONICAL=Q80WK7-1" }, "locus": { "chromosome": "20", "start_pos": 28683333, "end_pos": 28648519, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000107399.1", "url": "https://www.ensembl.org/id/ENSRNOT00000107399.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095273.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095273.1" } ] } }, { "isoform_ac": "A0A8L2Q0D9-1", "url": "", "sequence": { "sequence": "MAFASEDIAYHSSNAVYRVPSNRHEADQEALLGKPLDYPAPGLQRPEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAFKLRNCSSPASGKDPEDADILNYFESYLAVASTVPSLLFLVANFLLVNRIRVHVRVLASLSVSLAIFVVMAVLVRVDTSSWTRGFFSIAMACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGTT", "length": 206, "header": "tr|A0A8L2Q0D9-1|S29A3_RAT Computationally mapped isoform of Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=1 CANONICAL=Q80WK7-1" }, "locus": { "chromosome": "20", "start_pos": 28685310, "end_pos": 28649163, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000000689.6", "url": "https://www.ensembl.org/id/ENSRNOT00000000689.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000000689.6", "url": "https://www.ensembl.org/id/ENSRNOP00000000689.6" } ] } }, { "isoform_ac": "Q80WK7-1", "url": "", "sequence": { "sequence": "MAFASEDIAYHSSNAVYRVPSNRHEADQEALLGKPLDYPAPGLQRPEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAFKLRNCSSPASGKDPEDADILNYFESYLAVASTVPSLLFLVANFLLVNRIRVHVRVLASLSVSLAIFVVMAVLVRVDTSSWTRGFFSIAMACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVASLVDLAASSDVRDSALAFFLTAAVFLGLCVGLYLLLPQLEYARYYMRPVVPIHVFSSEDSPPRDAPSTSSVAPASRAVHTPPLGPILKKTAGLGFCAVFLYFITALIFPAISTNIQPMHKGTGSPWTSKFYVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPILAVSRVCLVPLFLLCNYQPRSHLTLVLFQSDIYPILFTCLLGLSNGYLSTLVLMYGPKIVPRELAEATSVVMLFYMSLGLMLGSACAALLEHFI", "length": 475, "header": "sp|Q80WK7-1|S29A3_RAT Isoform 1 of Equilibrative nucleoside transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc29a3 PE=1 SV=2 CANONICAL=Q80WK7-1" }, "locus": { "chromosome": "20", "start_pos": 28685310, "end_pos": 28648519, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000113968", "url": "https://www.ensembl.org/id/ENSRNOT00000113968" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082643", "url": "https://www.ensembl.org/id/ENSRNOP00000082643" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "Q80WK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80WK7#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "site_lbl": "Ser21" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Functional characterization of novel human and mouse equilibrative nucleoside transporters (hENT3 and mENT3) located in intracellular membranes.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Baldwin SA, Yao SY, Hyde RJ, Ng AM, Foppolo S, Barnes K, Ritzel MW, Cass CE, Young JD", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "reference": [ { "type": "PubMed", "id": "15701636", "url": "https://glygen.org/publication/PubMed/15701636" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:353307", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:353307", "resource": "KEGG Pathway" }, { "id": "R-RNO-83936", "name": "Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-83936", "resource": "Reactome", "description": "Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane" }, { "id": "R-RNO-9755088", "name": "Ribavirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9755088", "resource": "Reactome", "description": "Ribavirin ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "Q99P65-1", "protein_name": "Equilibrative nucleoside transporter 3", "gene_name": "Slc29a3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAFASEDNVYHSSNAVYRAPSNHQEADQEALLGKLLDYPAPGLQRPEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAYKLRNCSSPASGEDPEDMDILNYFESYLAVASTVPSLLFLVANFLLVNRVQVHVRVLASLSVSLAIFVVMIVLVKVDTSSWTRGFFSLTIACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVALLVDLAASSDVRDSTLAFFLMAAVFLGLCMGLYLLLSQLEYARYYMRPVAPVRVFSGEDNPSQDAPSASSVAPASRVMHTPPLGPILKKTASLGFCAVSLYFVTAFIIPAISTNIQSMHKGTGSPWTSKFFVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPGLVVSRFCLVPLFLLCNYQPRSHLTKVLFQSDIYPVLFTCLLGLSNGYLSTLVLIYGPKIVPRELAEATSVVMLFYMSVGLMLGSACAALLEHFI", "length": 475 }, "evidence": [ { "id": "45238429", "url": "http://www.informatics.jax.org/homology/45238429", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BZD2-1", "protein_name": "Equilibrative nucleoside transporter 3", "gene_name": "SLC29A3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSLGIGSLLPWNFFITAKEYWMFKLRNSSSPATGEDPEGSDILNYFESYLAVASTVPSMLCLVANFLLVNRVAVHIRVLASLTVILAIFMVITALVKVDTSSWTRGFFAVTIVCMVILSGASTVFSSSIYGMTGSFPMRNSQALISGGAMGGTVSAVASLVDLAASSDVRNSALAFFLTATVFLVLCMGLYLLLSRLEYARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKTASLGFCVTYVFFITSLIYPAICTNIESLNKGSGSLWTTKFFIPLTTFLLYNFADLCGRQLTAWIQVPGPNSKALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPALLSSLLGLSNGYLSTLALLYGPKIVPRELAEATGVVMSFYVCLGLTLGSACSTLLVHLI", "length": 475 }, "evidence": [ { "id": "45238429", "url": "http://www.informatics.jax.org/homology/45238429", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "nucleoside transmembrane transporter activity", "id": "GO:0005337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005337", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "neurotransmitter transmembrane transporter activity", "id": "GO:0005326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005326", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "nucleobase transmembrane transporter activity", "id": "GO:0015205", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015205", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "cytidine transmembrane transporter activity", "id": "GO:0015212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015212", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "uridine transmembrane transporter activity", "id": "GO:0015213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015213", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "monoamine transmembrane transporter activity", "id": "GO:0008504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008504", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "organic cation transmembrane transporter activity", "id": "GO:0015101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015101", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "guanine transmembrane transporter activity", "id": "GO:0015208", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015208", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "uracil transmembrane transporter activity", "id": "GO:0015210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015210", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "nucleobase transport", "id": "GO:0015851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015851", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "cytidine transport", "id": "GO:0015861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015861", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "nucleoside transport", "id": "GO:0015858", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015858", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "uridine transport", "id": "GO:0015862", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015862", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "dopamine transport", "id": "GO:0015872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015872", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "norepinephrine transport", "id": "GO:0015874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015874", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "serotonin transport", "id": "GO:0006837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006837", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "nucleoside transmembrane transport", "id": "GO:1901642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901642", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "purine nucleobase transmembrane transport", "id": "GO:1904823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904823", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "adenosine transport", "id": "GO:0032238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032238", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "inosine transport", "id": "GO:0035340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035340", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "guanine transmembrane transport", "id": "GO:1903716", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903716", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "uracil transmembrane transport", "id": "GO:1903791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903791", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" }, { "name": "pyrimidine nucleobase transmembrane transport", "id": "GO:1904082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904082", "evidence": [ { "database": "UniProtKB", "id": "Q80WK7", "url": "https://www.uniprot.org/uniprot/Q80WK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 183, "end_pos": 185, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "69404", "name": "", "equation": "uracil(in) = uracil(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "69404", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/69404" } ] }, { "id": "71519", "name": "", "equation": "uridine(out) = uridine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71519", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71519" } ] }, { "id": "71531", "name": "", "equation": "guanine(out) = guanine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71531", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71531" } ] }, { "id": "73863", "name": "", "equation": "dopamine(out) = dopamine(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73863", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73863" } ] }, { "id": "73867", "name": "", "equation": "serotonin(out) = serotonin(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73867", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73867" } ] }, { "id": "73871", "name": "", "equation": "(R)-noradrenaline(out) = (R)-noradrenaline(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73871", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73871" } ] }, { "id": "74783", "name": "", "equation": "tyramine(in) = tyramine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "74783", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/74783" } ] }, { "id": "75343", "name": "", "equation": "adenosine(in) = adenosine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75343", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75343" } ] }, { "id": "75363", "name": "", "equation": "thymidine(in) = thymidine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75363", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75363" } ] }, { "id": "75367", "name": "", "equation": "cytidine(in) = cytidine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75367", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75367" } ] }, { "id": "75371", "name": "", "equation": "guanosine(in) = guanosine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75371", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75371" } ] }, { "id": "75375", "name": "", "equation": "inosine(in) = inosine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75375", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75375" } ] }, { "id": "75687", "name": "", "equation": "ATP(in) = ATP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75687", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75687" } ] }, { "id": "75691", "name": "", "equation": "2'-deoxyadenosine(in) = 2'-deoxyadenosine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75691", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75691" } ] }, { "id": "75695", "name": "", "equation": "2'-deoxycytidine(in) = 2'-deoxycytidine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "75695", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/75695" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }