{ "uniprot_canonical_ac": "Q80UY1-1", "uniprot_ac": "Q80UY1", "uniprot_id": "CARME_MOUSE", "mass": { "chemical_mass": 46339.0, "monoisotopic_mass": 46339.0 }, "refseq": { "ac": "NP_080396", "name": "carnosine N-methyltransferase isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396" }, "gene_names": [ { "name": "Carnmt1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80UY1", "id": "Q80UY1" }, { "name": "2410127L17Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396", "id": "NP_080396" }, { "name": "Carnmt1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396", "id": "NP_080396" } ], "protein_names": [ { "name": "Carnosine N-methyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q80UY1" }, { "name": "2.1.1.22", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80UY1" }, { "name": "UPF0586 protein C9orf41 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396", "id": "NP_080396" }, { "name": "carnosine N-methyltransferase isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396", "id": "NP_080396" } ], "function": [ { "annotation": "Histidine N1-position-specific methyltransferase CARNMT1 targets C3H zinc finger proteins and modulates RNA metabolism.", "evidence": [ { "database": "RefSeq", "id": "NP_080396", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396" }, { "database": "PubMed", "id": "37612136", "url": "https://glygen.org/publication/PubMed/37612136" } ] }, { "annotation": "N-methyltransferase that catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of vertebrate skeletal muscles. Also methylates other L-histidine-containing di- and tripeptides such as Gly-Gly-His, Gly-His and homocarnosine (GABA-His).", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1#function" }, { "database": "UniProtKB", "id": "Q5BJZ6", "url": "https://www.uniprot.org/uniprot/Q5BJZ6#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Carnmt1", "url": "https://www.uniprot.org/uniprot/Q80UY1", "locus": { "chromosome": "19", "start_pos": 18684564, "end_pos": 18648128, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024726", "url": "https://www.ensembl.org/id/ENSMUSG00000024726" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024726", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024726", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "67383", "url": "https://www.ncbi.nlm.nih.gov/gene/67383", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q80UY1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q80UY1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR012901", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012901", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67383", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67383", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914633", "url": "http://www.informatics.jax.org/marker/MGI:1914633", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GSMSMCA", "url": "https://omabrowser.org/oma/group/GSMSMCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "167229at2759", "url": "http://www.orthodb.org/?query=167229at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12303", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12303", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12303:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12303:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07942", "url": "http://pfam.xfam.org/family/PF07942", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q80UY1", "url": "http://purl.obolibrary.org/obo/PR_Q80UY1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-70921", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70921", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_080396", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "14205", "url": "https://www.rhea-db.org/rhea/14205", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A494BA54", "url": "https://www.uniprot.org/uniprot/A0A494BA54", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BA54-1", "url": "https://www.uniprot.org/uniprot/A0A494BA54-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80UY1-1", "url": "https://www.uniprot.org/uniprot/Q80UY1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQRRQRAPPASQPAQDGGRSEDVEVQFSAGRLGSAAPAGPPARGTAEDEERLEREHFWKVINAFRYYGTSMHERVNRTERQFRSLPENQQKLLPQFPLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYGEDANGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYKPIIKEIIKNFPKERWDPSKVNILVPGAGLGRLAWEVAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPILFPDVDPHSLPPGSNFSMTAGDFQEIYSECNAWDCIATCFFIDTAHNVIDYIDTIWRILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFQLEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ", "length": 400, "header": "sp|Q80UY1-1|CARME_MOUSE Isoform 1 of Carnosine N-methyltransferase OS=Mus musculus OX=10090 GN=Carnmt1 PE=1 SV=1 CANONICAL=Q80UY1-1" }, "isoforms": [ { "isoform_ac": "A0A494BA54-1", "url": "", "sequence": { "sequence": "MQRRQRAPPASQPAQDGGRSEDVEVQFSAGRLGSAAPAGPPARGTAEDEERLEREHFWKVINAFRYYG", "length": 68, "header": "tr|A0A494BA54-1|CARME_MOUSE Computationally mapped isoform of Carnosine N-methyltransferase OS=Mus musculus OX=10090 GN=Carnmt1 PE=1 SV=1 CANONICAL=Q80UY1-1" }, "locus": {} }, { "isoform_ac": "Q80UY1-1", "url": "", "sequence": { "sequence": "MQRRQRAPPASQPAQDGGRSEDVEVQFSAGRLGSAAPAGPPARGTAEDEERLEREHFWKVINAFRYYGTSMHERVNRTERQFRSLPENQQKLLPQFPLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYGEDANGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYKPIIKEIIKNFPKERWDPSKVNILVPGAGLGRLAWEVAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPILFPDVDPHSLPPGSNFSMTAGDFQEIYSECNAWDCIATCFFIDTAHNVIDYIDTIWRILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFQLEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ", "length": 400, "header": "sp|Q80UY1-1|CARME_MOUSE Isoform 1 of Carnosine N-methyltransferase OS=Mus musculus OX=10090 GN=Carnmt1 PE=1 SV=1 CANONICAL=Q80UY1-1" }, "locus": { "chromosome": "19", "start_pos": 18681482, "end_pos": 18648364, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000025632", "url": "https://www.ensembl.org/id/ENSMUST00000025632" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000025632", "url": "https://www.ensembl.org/id/ENSMUSP00000025632" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Histidine N1-position-specific methyltransferase CARNMT1 targets C3H zinc finger proteins and modulates RNA metabolism.", "journal": "Genes & development", "date": "2023-08-01", "authors": "Shimazu Tadahiro, Yoshimoto Rei, Kotoshiba Kaoru, Suzuki Takehiro, Matoba Shogo, Hirose Michiko, Akakabe Mai, Sohtome Yoshihiro, Sodeoka Mikiko, Ogura Atsuo, Dohmae Naoshi, Shinkai Yoichi", "evidence": [ { "database": "RefSeq", "id": "NP_080396", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080396" } ], "reference": [ { "type": "PubMed", "id": "37612136", "url": "https://glygen.org/publication/PubMed/37612136" } ] } ], "pathway": [ { "id": "mmu:67383", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67383", "resource": "KEGG Pathway" }, { "id": "R-MMU-70921", "name": "Histidine catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70921", "resource": "Reactome", "description": "Histidine catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5BJZ6-1", "protein_name": "Carnosine N-methyltransferase", "gene_name": "Carnmt1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQRRRRAPPASQPAQDSGHSEEVEVQFSAGRLGSAAPAGPPVRGTAEDEERLEREHFWKVINAFRYYGTSMHERVNRTERQFRSLPDNQQKLLPQFPLHLDKIRKCVDHNQEILLTIVNDCIHMFENKEYGEDANGKIMPASTFDMDKLKSTLKQFVRDWSGTGKAERDACYKPIIKEIIKNFPKERWDPSKVNILVPGAGLGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEVDKYKLYPWIHQFSNNRRSADQIRPIFFPDVDPHSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWRILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFQLEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ", "length": 400 }, "evidence": [ { "id": "45238993", "url": "http://www.informatics.jax.org/homology/45238993", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8N4J0-1", "protein_name": "Carnosine N-methyltransferase", "gene_name": "CARNMT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKIINAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYGEDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAGLGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDPHSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ", "length": 409 }, "evidence": [ { "id": "45238993", "url": "http://www.informatics.jax.org/homology/45238993", "database": "MGI" }, { "id": "Q80UY1", "url": "https://omabrowser.org/oma/group/Q80UY1/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9I7X6-1", "protein_name": "Carnosine N-methyltransferase", "gene_name": "", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSSMDCATFPMHPKMDEQLARTFVINEEEEEKHIQKVQNAFLYYGPYACQRLKRSMDYLNSLSGEDQIMLAKYRGHLECVRTCIDRNQAVIREILRGRVLYPTDEATGDPSEFDEPPPNVRHGDMDQAQSTLKLIARDWSTEGALEREQSYKPIIDSIVAYFKHSDFELKDIKILVPGAGLGRLTYELACLGYSCEGNEFSYFMLIASNFVLNLCDNENKYVLYPWVHQYVNNLRREDQVAPVRFPDVCPLKNPPKGHFEIAAGDFLEVYKTPNAYNCVATCFFIDCANNVIDFIRTIYKILVPGGIWVNLGPLLYHFSDVSGQNSIEPAFEDLCIIMESVGFVIEKSRTGIRTKYAQNPSSMKQSEYQSLFWVCRKPDLFEEQRGKRKASREPHDLIVREDSEEEGEQQPERNETEEKQQLKPLATANCETEIKEQPS", "length": 439 }, "evidence": [ { "id": "Q80UY1", "url": "https://omabrowser.org/oma/group/Q80UY1/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" }, { "name": "S-adenosylmethionine-dependent methyltransferase activity", "id": "GO:0008757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008757", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" }, { "name": "carnosine N-methyltransferase activity", "id": "GO:0030735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030735", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" }, { "name": "carnosine metabolic process", "id": "GO:0035498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035498", "evidence": [ { "database": "UniProtKB", "id": "Q80UY1", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 279, "end_pos": 281, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14205", "name": "", "equation": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5BJZ6-1", "Q8N4J0-1", "Q80UY1-1", "P53934-1", "Q54ST2-1", "Q9I7X6-1" ], "evidence": [ { "id": "14205", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14205" } ] }, { "id": "R-MMU-8876789", "name": "CARNMT1 methylates CARN to Anserine", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-8876775" ], "enzyme_list": [ "Q80UY1-1" ], "evidence": [ { "id": "R-MMU-8876789", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8876789" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-8876775", "participant_name": "Anserine [cytosol]", "crossref": [ { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" }, { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" }, { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" }, { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" }, { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" }, { "id": "58445", "database": "ChEBI", "url": "" }, { "id": "000001532910", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P53934", "gene_name": "", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P53934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53934" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "P53934", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53934" } ] } ] }, { "uniprot_ac": "Q54ST2", "gene_name": "", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54ST2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ST2" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "Q54ST2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54ST2" } ] } ] }, { "uniprot_ac": "Q5BJZ6", "gene_name": "Carnmt1", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q5BJZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJZ6" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "Q5BJZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJZ6" } ] } ] }, { "uniprot_ac": "Q80UY1", "gene_name": "Carnmt1", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q80UY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "Q80UY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UY1" } ] } ] }, { "uniprot_ac": "Q8N4J0", "gene_name": "CARNMT1", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8N4J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4J0" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "Q8N4J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N4J0" } ] } ] }, { "uniprot_ac": "Q9I7X6", "gene_name": "", "activity": [ { "ec_number": "2.1.1.22", "activity": "carnosine + S-adenosyl-L-methionine = anserine + H(+) + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9I7X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7X6" } ] }, { "ec_number": "2.1.1.22", "activity": "", "evidence": [ { "id": "Q9I7X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7X6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }