{ "uniprot_canonical_ac": "Q80SS6-1", "uniprot_ac": "Q80SS6", "uniprot_id": "GPBAR_MOUSE", "mass": { "chemical_mass": 35650.0, "monoisotopic_mass": 35650.0 }, "refseq": { "ac": "NP_778150", "name": "G-protein coupled bile acid receptor 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, "gene_names": [ { "name": "Gpbar1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q80SS6", "id": "Q80SS6" }, { "name": "BG37; GPCR; GPR131; M-BAR; TGR5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150", "id": "NP_778150" }, { "name": "Gpbar1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150", "id": "NP_778150" }, { "name": "Tgr5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q80SS6", "id": "Q80SS6" } ], "protein_names": [ { "name": "G-protein coupled bile acid receptor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q80SS6" }, { "name": "G protein-coupled receptor TGR5; membrane bile acid receptor; membrane-type receptor for bile acids", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150", "id": "NP_778150" }, { "name": "G-protein coupled bile acid receptor 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150", "id": "NP_778150" }, { "name": "M-BAR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80SS6" }, { "name": "Membrane-type receptor for bile acids", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q80SS6" } ], "function": [ { "annotation": "Activation of the bile acid receptors TGR5 and FXR in the spinal dorsal horn alleviates neuropathic pain.", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "36880297", "url": "https://glygen.org/publication/PubMed/36880297" } ] }, { "annotation": "Bile acids induce GLP-1 secretion through TGR5 and intracellular cAMP production in STC-1 cells", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "15721318", "url": "https://glygen.org/publication/PubMed/15721318" } ] }, { "annotation": "Gpbar1 plays a critical role in the formation of gallstones, possibly via a regulatory mechanism involving the cholesterol 7alpha-hydroxylase pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "16724960", "url": "https://glygen.org/publication/PubMed/16724960" } ] }, { "annotation": "Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids (By similarity). Involved in bile acid promoted GLP1R secretion.", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6#function" }, { "database": "PubMed", "id": "15721318", "url": "https://glygen.org/publication/PubMed/15721318" } ] }, { "annotation": "TGR5 is implicated in the suppression of macrophage functions by bile acids", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "12524422", "url": "https://glygen.org/publication/PubMed/12524422" } ] }, { "annotation": "Tgr5-/- mice are protected from ethanol-induced metabolic alterations through enhanced leptin and Fgf21 signaling. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "37185802", "url": "https://glygen.org/publication/PubMed/37185802" } ] }, { "annotation": "The degradation of TGR5 mediated by Smurf1 contributes to diabetic nephropathy.", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" }, { "database": "PubMed", "id": "37481723", "url": "https://glygen.org/publication/PubMed/37481723" } ] } ], "disease": [ { "disease_id": "DOID:0080322", "recommended_name": { "id": "DOID:0080322", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080322", "name": "polycystic kidney disease", "description": "A cystic kidney disease that is characterized by the growth of fluid-filled cysts in the kidneys that reduces kidney function and may lead to kidney failure." }, "synonyms": [ { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the PKD1 gene." }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "APKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "PKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "PKD1 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease type 1", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult, type I", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "Potter type 3 polycystic kidney disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "Potter type 3 polycystic kidney disease, formerly", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease 1 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult", "description": "" }, { "id": "MONDO:0008263", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008263", "name": "polycystic kidney disease, adult, type 1", "description": "" }, { "id": "MIM:173900", "resource": "MIM", "url": "https://www.omim.org/entry/173900", "name": "Polycystic kidney disease 1 with or without polycystic liver disease", "description": "Polycystic kidney disease 1 with or without polycystic liver disease" } ], "evidence": [ { "id": "0080322", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080322" } ] }, { "disease_id": "DOID:0080547", "recommended_name": { "id": "DOID:0080547", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080547", "name": "metabolic dysfunction-associated steatohepatitis", "description": "A metabolic dysfunction-associated steatotic liver disease characterized by the presence of inflammation with hepatocyte injury such as ballooning, with or without fibrosis." }, "synonyms": [ { "id": "DOID:0080547", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080547", "name": "non-alcoholic steatohepatitis", "description": "" }, { "id": "DOID:0080547", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080547", "name": "NASH", "description": "" }, { "id": "DOID:0080547", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080547", "name": "MASH", "description": "" }, { "id": "DOID:0080547", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080547", "name": "nonalcoholic steatohepatitis", "description": "" } ], "evidence": [ { "id": "0080547", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080547" } ] }, { "disease_id": "DOID:0110861", "recommended_name": { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "autosomal recessive polycystic kidney disease", "description": "A polycystic kidney disease characterized by the presence of multiple cysts located_in the kidney resulting from ciliopathy that disrupts the function of primary cilium, inherited in an autosomal recessive fashion." }, "synonyms": [ { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Arpkd", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Pkhd1", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Polycystic Kidney Disease, Infantile, Type I", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Polycystic Kidney and Hepatic Disease 1", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4", "description": "A autosomal dominant polycystic kidney disease that has material basis in mutation in the PKD4 gene." }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4, with or without hepatic disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD3", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD3, formerly", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD4", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "hepatic fibrosis, congenital", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney and hepatic disease 1", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4 with or without hepatic disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease, autosomal recessive", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease, infantile, type 1", "description": "" }, { "id": "MIM:263200", "resource": "MIM", "url": "https://www.omim.org/entry/263200", "name": "Polycystic kidney disease 4, with or without polycystic liver disease", "description": "Polycystic kidney disease 4, with or without polycystic liver disease" } ], "evidence": [ { "id": "0110861", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110861" } ] }, { "disease_id": "DOID:898", "recommended_name": { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "autosomal dominant polycystic kidney disease", "description": "A polycystic kidney disease characterized by the presence of multiple cysts located_in the kidney resulting from ciliopathy that disrupts the function of primary cilium, inherited in an autosomal dominant fashion." }, "synonyms": [ { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "Congenital biliary ectasias", "description": "" }, { "id": "DOID:898", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:898", "name": "POLYCYSTIC KIDNEY AND HEPATIC DISEASE 1", "description": "" } ], "evidence": [ { "id": "898", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:898" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gpbar1", "url": "https://www.uniprot.org/uniprot/Q80SS6", "locus": { "chromosome": "1", "start_pos": 74318783, "end_pos": 74317709, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000064272", "url": "https://www.ensembl.org/id/ENSMUSG00000064272" } ] } } ], "crossref": [ { "id": "ENSMUSG00000064272", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000064272", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL1255150", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1255150", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "227289", "url": "https://www.ncbi.nlm.nih.gov/gene/227289", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:227289", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:227289", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2653863", "url": "http://www.informatics.jax.org/marker/MGI:2653863", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DICRLHR", "url": "https://omabrowser.org/oma/group/DICRLHR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5359988at2759", "url": "http://www.orthodb.org/?query=5359988at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24246", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24246", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24246:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24246:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q80SS6", "url": "http://purl.obolibrary.org/obo/PR_Q80SS6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-373076", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-373076", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q80SS6-1", "url": "https://www.uniprot.org/uniprot/Q80SS6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN", "length": 329, "header": "sp|Q80SS6-1|GPBAR_MOUSE Isoform 1 of G-protein coupled bile acid receptor 1 OS=Mus musculus OX=10090 GN=Gpbar1 PE=2 SV=1 CANONICAL=Q80SS6-1" }, "isoforms": [ { "isoform_ac": "Q80SS6-1", "url": "", "sequence": { "sequence": "MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN", "length": 329, "header": "sp|Q80SS6-1|GPBAR_MOUSE Isoform 1 of G-protein coupled bile acid receptor 1 OS=Mus musculus OX=10090 GN=Gpbar1 PE=2 SV=1 CANONICAL=Q80SS6-1" }, "locus": { "chromosome": "1", "start_pos": 74318745, "end_pos": 74317759, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000077985", "url": "https://www.ensembl.org/id/ENSMUST00000077985" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077135", "url": "https://www.ensembl.org/id/ENSMUSP00000077135" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 153, "start_aa": "Asn", "end_pos": 153, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn153", "evidence": [ { "id": "Q80SS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80SS6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "Q80SS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80SS6#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of membrane-type receptor for bile acids (M-BAR).", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Maruyama T, Miyamoto Y, Nakamura T, Tamai Y, Okada H, Sugiyama E, Nakamura T, Itadani H, Tanaka K", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "reference": [ { "type": "PubMed", "id": "12419312", "url": "https://glygen.org/publication/PubMed/12419312" } ] }, { "title": "A G protein-coupled receptor responsive to bile acids.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kawamata Y, Fujii R, Hosoya M, Harada M, Yoshida H, Miwa M, Fukusumi S, Habata Y, Itoh T, Shintani Y, Hinuma S, Fujisawa Y, Fujino M", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" }, { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "12524422", "url": "https://glygen.org/publication/PubMed/12524422" } ] }, { "title": "Bile acids promote glucagon-like peptide-1 secretion through TGR5 in a murine enteroendocrine cell line STC-1.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Katsuma S, Hirasawa A, Tsujimoto G", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" }, { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "15721318", "url": "https://glygen.org/publication/PubMed/15721318" } ] }, { "title": "Targeted deletion of Gpbar1 protects mice from cholesterol gallstone formation.", "journal": "The Biochemical journal", "date": "2006", "authors": "Vassileva G, Golovko A, Markowitz L, Abbondanzo SJ, Zeng M, Yang S, Hoos L, Tetzloff G, Levitan D, Murgolo NJ, Keane K, Davis HR Jr, Hedrick J, Gustafson EL", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "16724960", "url": "https://glygen.org/publication/PubMed/16724960" } ] }, { "title": "Activation of the bile acid receptors TGR5 and FXR in the spinal dorsal horn alleviates neuropathic pain.", "journal": "CNS neuroscience & therapeutics", "date": "2023-07", "authors": "Wu Yuning, Qiu Yuxin, Su Minzhi, Wang Linjie, Gong Qingjuan, Wei Xuhong", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "36880297", "url": "https://glygen.org/publication/PubMed/36880297" } ] }, { "title": "Tgr5-/- mice are protected from ethanol-induced metabolic alterations through enhanced leptin and Fgf21 signaling.", "journal": "Hepatology communications", "date": "2023-05-01", "authors": "Pokhrel Sabita, Dilts Matthew, Stahl Zachary, Boehme Shannon, Frame Gabrielle, Chiang John Y L, Ferrell Jessica M", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "37185802", "url": "https://glygen.org/publication/PubMed/37185802" } ] }, { "title": "The degradation of TGR5 mediated by Smurf1 contributes to diabetic nephropathy.", "journal": "Cell reports", "date": "2023-08-29", "authors": "Lin Zeyuan, Li Shanshan, Xiao Haiming, Xu Zhanchi, Li Chuting, Zeng Jingran, Wang Shaogui, Liu Zhongqiu, Huang Heqing", "evidence": [ { "database": "RefSeq", "id": "NP_778150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778150" } ], "reference": [ { "type": "PubMed", "id": "37481723", "url": "https://glygen.org/publication/PubMed/37481723" } ] } ], "pathway": [ { "id": "mmu:227289", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:227289", "resource": "KEGG Pathway" }, { "id": "R-MMU-373076", "name": "Class A/1 (Rhodopsin-like receptors)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-373076", "resource": "Reactome", "description": "Class A/1 (Rhodopsin-like receptors)" }, { "id": "R-MMU-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "Q80T02-1", "protein_name": "G-protein coupled bile acid receptor 1", "gene_name": "Gpbar1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSSQCSTDLDLN", "length": 329 }, "evidence": [ { "id": "45231469", "url": "http://www.informatics.jax.org/homology/45231469", "database": "MGI" }, { "id": "Q80SS6", "url": "https://omabrowser.org/oma/group/Q80SS6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G-protein coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN", "length": 330 }, "evidence": [ { "id": "45231469", "url": "http://www.informatics.jax.org/homology/45231469", "database": "MGI" }, { "id": "Q80SS6", "url": "https://omabrowser.org/oma/group/Q80SS6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "bile acid receptor activity", "id": "GO:0038181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038181", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "G protein-coupled bile acid receptor activity", "id": "GO:0038182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038182", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "receptor complex", "id": "GO:0043235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "positive regulation of cholangiocyte proliferation", "id": "GO:1904056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904056", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "regulation of bicellular tight junction assembly", "id": "GO:2000810", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000810", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "cell surface bile acid receptor signaling pathway", "id": "GO:0038184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038184", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" }, { "name": "cellular response to bile acid", "id": "GO:1903413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903413", "evidence": [ { "database": "UniProtKB", "id": "Q80SS6", "url": "https://www.uniprot.org/uniprot/Q80SS6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 153, "end_pos": 155, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }