{
    "uniprot_canonical_ac": "Q7TQT7-1",
    "uniprot_ac": "Q7TQT7",
    "uniprot_id": "Q7TQT7_MOUSE",
    "mass": {
        "chemical_mass": 34513.0,
        "monoisotopic_mass": 34513.0
    },
    "refseq": {
        "ac": "NP_997136",
        "name": "olfactory receptor family 2 subfamily Y member 6",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136"
    },
    "gene_names": [
        {
            "name": "Or2y6",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q7TQT7",
            "id": "Q7TQT7"
        },
        {
            "name": "GA_x6K02T2QP88-3214035-3214970; MOR256-58; Olfr1371",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136",
            "id": "NP_997136"
        },
        {
            "name": "Olfr1371",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q7TQT7",
            "id": "Q7TQT7"
        },
        {
            "name": "Or2y6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136",
            "id": "NP_997136"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q7TQT7"
        },
        {
            "name": "olfactory receptor GA_x6K02T2QP88-3214035-3214970; olfactory receptor 1371",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136",
            "id": "NP_997136"
        },
        {
            "name": "olfactory receptor family 2 subfamily Y member 6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136",
            "id": "NP_997136"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_997136",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q7TQT7",
                    "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Or2y6",
            "url": "https://www.uniprot.org/uniprot/Q7TQT7",
            "locus": {
                "chromosome": "11",
                "start_pos": 52103879,
                "end_pos": 52104814,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000060170",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000060170"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd15947",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15947",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "276865",
            "url": "https://www.ncbi.nlm.nih.gov/gene/276865",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:276865",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:276865",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "3031205",
            "url": "http://www.informatics.jax.org/marker/MGI:3031205",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "TIIPISH",
            "url": "https://omabrowser.org/oma/group/TIIPISH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4790557at2759",
            "url": "http://www.orthodb.org/?query=4790557at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR26453",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR26453:SF228",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF228",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_997136",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997136",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q7TQT7",
            "url": "https://www.uniprot.org/uniprot/Q7TQT7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q7TQT7-1",
            "url": "https://www.uniprot.org/uniprot/Q7TQT7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MENLNTSSEEGFILVVFSDWPHLEPILFAFISIFYSLTLFGNTVIIILSQLDLCLHTPMYYFLCHLSFLDLCYTASTVPQLLVNLSGLDRTISFGRCVAQLCIVLSLGGTECVLLVAMAIDRYAAVCRPLHYTTIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEVNLFVARVIILVCPLLLILGSYAHIARAVLNIRSMAGRRKAFGTCASHLIVVAMFYGSGISTYLQPVHRYSEKEGKFLALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRSTDSA",
        "length": 311,
        "header": "tr|Q7TQT7-1|Q7TQT7_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Or2y6 PE=2 SV=1 CANONICAL=Q7TQT7-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q7TQT7-1",
            "url": "",
            "sequence": {
                "sequence": "MENLNTSSEEGFILVVFSDWPHLEPILFAFISIFYSLTLFGNTVIIILSQLDLCLHTPMYYFLCHLSFLDLCYTASTVPQLLVNLSGLDRTISFGRCVAQLCIVLSLGGTECVLLVAMAIDRYAAVCRPLHYTTIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEVNLFVARVIILVCPLLLILGSYAHIARAVLNIRSMAGRRKAFGTCASHLIVVAMFYGSGISTYLQPVHRYSEKEGKFLALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRSTDSA",
                "length": 311,
                "header": "tr|Q7TQT7-1|Q7TQT7_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Or2y6 PE=2 SV=1 CANONICAL=Q7TQT7-1"
            },
            "locus": {
                "chromosome": "11",
                "start_pos": 52104814,
                "end_pos": 52103882,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000075844.4",
                        "url": "https://www.ensembl.org/id/ENSMUST00000075844.4"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000075241.4",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000075241.4"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "mmu:276865",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:276865",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A8I5ZR60-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Or2y11",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MLLDNEEDASTSRVMPLHIFCWMCYVDLSRTGALTRVFPTTGEIGTKKKSFCQTSGFSIFRWSHLSFKPNTFEESTSGSFPTLNSRWNIMEYLNTSSEKGFILVGFSDWPHLEPIFFALISIFYSLTLFGNTVIIILSRLDLRLHTPMYYFLCHLSFLDLCYTTSTVPQLLVNLSGLDRTISFGRCVAQLCIVLSLGGTECVLLVTMAIDRYAAVCRPLHYTTIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEANLFVARVIILVCPLVLILGSYAHIARAVLNIKSMAGRRKAFGTCASHLIVVAMFYGSAVSTYLQPVHRYSEKEGKFLALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRGTDSA",
                "length": 400
            },
            "evidence": [
                {
                    "id": "45242810",
                    "url": "http://www.informatics.jax.org/homology/45242810",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q8NGV0-1",
            "protein_name": "Olfactory receptor 2Y1",
            "gene_name": "OR2Y1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMYFFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAFDRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEMPVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTCGSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGALWKVLWRGRDSG",
                "length": 311
            },
            "evidence": [
                {
                    "id": "45242810",
                    "url": "http://www.informatics.jax.org/homology/45242810",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "detection of chemical stimulus involved in sensory perception of smell",
                        "id": "GO:0050911",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7TQT7",
                                "url": "https://www.uniprot.org/uniprot/Q7TQT7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 5,
            "end_pos": 7,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 84,
            "end_pos": 86,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}