{ "uniprot_canonical_ac": "Q7TQH7-1", "uniprot_ac": "Q7TQH7", "uniprot_id": "LRP10_MOUSE", "mass": { "chemical_mass": 76461.0, "monoisotopic_mass": 76461.0 }, "refseq": { "ac": "NP_075369", "name": "low-density lipoprotein receptor-related protein 10 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369" }, "gene_names": [ { "name": "Lrp10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q7TQH7", "id": "Q7TQH7" }, { "name": "Lrp10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369", "id": "NP_075369" }, { "name": "Lrp9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369", "id": "NP_075369" }, { "name": "Lrp9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7TQH7", "id": "Q7TQH7" } ], "protein_names": [ { "name": "Low-density lipoprotein receptor-related protein 10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q7TQH7" }, { "name": "LRP-10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369", "id": "NP_075369" }, { "name": "LRP-10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TQH7" }, { "name": "low-density lipoprotein receptor-related protein 10 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369", "id": "NP_075369" } ], "function": [ { "annotation": "Data show that Calnuc is involved in LRP9 endosomal sorting to prevent the delivery of LRP9 to lysosomes.", "evidence": [ { "database": "RefSeq", "id": "NP_075369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369" }, { "database": "PubMed", "id": "19497050", "url": "https://glygen.org/publication/PubMed/19497050" } ] }, { "annotation": "Probable receptor, which is involved in the internalization of lipophilic molecules and/or signal transduction. May be involved in the uptake of lipoprotein APOE in liver.", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7#function" }, { "database": "PubMed", "id": "11123907", "url": "https://glygen.org/publication/PubMed/11123907" } ] }, { "annotation": "These results suggest that LRP9 cycles between the trans-Golgi network, endosomes and the plasma membrane through a GGA dependent-trafficking mechanism.", "evidence": [ { "database": "RefSeq", "id": "NP_075369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369" }, { "database": "PubMed", "id": "18461348", "url": "https://glygen.org/publication/PubMed/18461348" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389309924", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389309924" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 168, "end_pos": 168, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGS->NGS).", "chr_id": "14", "chr_pos": "54705313", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D168", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lrp10", "url": "https://www.uniprot.org/uniprot/Q7TQH7", "locus": { "chromosome": "14", "start_pos": 54708954, "end_pos": 54701594, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022175", "url": "https://www.ensembl.org/id/ENSMUSG00000022175" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022175", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022175", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00041", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00041", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00112", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00112", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "65107", "url": "https://www.ncbi.nlm.nih.gov/gene/65107", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0006005", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006005", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR000859", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000859", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023415", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023415", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035914", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035914", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:65107", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:65107", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1929480", "url": "http://www.informatics.jax.org/marker/MGI:1929480", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GRAPMGQ", "url": "https://omabrowser.org/oma/group/GRAPMGQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2916406at2759", "url": "http://www.orthodb.org/?query=2916406at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24270", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24270", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24270:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24270:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00057", "url": "http://pfam.xfam.org/family/PF00057", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00431", "url": "http://pfam.xfam.org/family/PF00431", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q7TQH7", "url": "http://purl.obolibrary.org/obo/PR_Q7TQH7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_075369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A2I3BQ24", "url": "https://www.uniprot.org/uniprot/A0A2I3BQ24", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2I3BQ24-1", "url": "https://www.uniprot.org/uniprot/A0A2I3BQ24-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2I3BRF1", "url": "https://www.uniprot.org/uniprot/A0A2I3BRF1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2I3BRF1-1", "url": "https://www.uniprot.org/uniprot/A0A2I3BRF1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TQH7-1", "url": "https://www.uniprot.org/uniprot/Q7TQH7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLSALPLLFLLLGGALARPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGTSGGRRRQRGRSIRRLVRRLRRWGLLPRTNTPARAPETRSQVTPSVPSEALDDSTGQACEGGAVGGQDGEQAPPLPIKTPIPTPSTLPALATVSEPPGPLPSVPVESSLLSGVVQVLRGRLLPSLWSPGPTWTQTGTHTTVLSPEDEDDVLLLPLAEPEVWVVEAEDEPLLA", "length": 713, "header": "sp|Q7TQH7-1|LRP10_MOUSE Isoform 1 of Low-density lipoprotein receptor-related protein 10 OS=Mus musculus OX=10090 GN=Lrp10 PE=2 SV=2 CANONICAL=Q7TQH7-1" }, "isoforms": [ { "isoform_ac": "A0A2I3BQ24-1", "url": "", "sequence": { "sequence": "XPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAASLPRSPGWRLRLCSNRHPLPMGSSLPRVPSRLWKTSPQRTLTITLCWETYVLCFRSYARI", "length": 131, "header": "tr|A0A2I3BQ24-1|A0A2I3BQ24_MOUSE Computationally mapped isoform of Low-density lipoprotein receptor-related protein 10 OS=Mus musculus OX=10090 GN=Lrp10 PE=4 SV=1 CANONICAL=Q7TQH7-1" }, "locus": { "chromosome": "14", "start_pos": 54706775, "end_pos": 54705010, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000228407.2", "url": "https://www.ensembl.org/id/ENSMUST00000228407.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000154017.2", "url": "https://www.ensembl.org/id/ENSMUSP00000154017.2" } ] } }, { "isoform_ac": "A0A2I3BRF1-1", "url": "", "sequence": { "sequence": "RDSRSSPANCTWVILGSKDQTVTVR", "length": 25, "header": "tr|A0A2I3BRF1-1|A0A2I3BRF1_MOUSE Computationally mapped isoform of Low-density lipoprotein receptor-related protein 10 OS=Mus musculus OX=10090 GN=Lrp10 PE=4 SV=1 CANONICAL=Q7TQH7-1" }, "locus": { "chromosome": "14", "start_pos": 54703167, "end_pos": 54703093, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000227760.2", "url": "https://www.ensembl.org/id/ENSMUST00000227760.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000154451.2", "url": "https://www.ensembl.org/id/ENSMUSP00000154451.2" } ] } }, { "isoform_ac": "Q7TQH7-1", "url": "", "sequence": { "sequence": "MLSALPLLFLLLGGALARPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGTSGGRRRQRGRSIRRLVRRLRRWGLLPRTNTPARAPETRSQVTPSVPSEALDDSTGQACEGGAVGGQDGEQAPPLPIKTPIPTPSTLPALATVSEPPGPLPSVPVESSLLSGVVQVLRGRLLPSLWSPGPTWTQTGTHTTVLSPEDEDDVLLLPLAEPEVWVVEAEDEPLLA", "length": 713, "header": "sp|Q7TQH7-1|LRP10_MOUSE Isoform 1 of Low-density lipoprotein receptor-related protein 10 OS=Mus musculus OX=10090 GN=Lrp10 PE=2 SV=2 CANONICAL=Q7TQH7-1" }, "locus": { "chromosome": "14", "start_pos": 54707303, "end_pos": 54702032, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000022782", "url": "https://www.ensembl.org/id/ENSMUST00000022782" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000022782", "url": "https://www.ensembl.org/id/ENSMUSP00000022782" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "Q7TQH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQH7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 194, "start_aa": "Asn", "end_pos": 194, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn194", "evidence": [ { "id": "Q7TQH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQH7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 300, "start_aa": "Asn", "end_pos": 300, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn300", "evidence": [ { "id": "Q7TQH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQH7#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 57, "start_aa": "Asn", "end_pos": 57, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn57", "evidence": [ { "id": "Q7TQH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQH7#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 596, "end_pos": 596, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "site_lbl": "Thr596" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "A novel low-density lipoprotein receptor-related protein mediating cellular uptake of apolipoprotein E-enriched beta-VLDL in vitro.", "journal": "Biochemistry", "date": "2000", "authors": "Kojima T., Sugiyama A., Sugiyama T., Yasuda K., Kodama T., Tamura S., Kadowaki T., Yokoi N., Kitamura T., Kimura S., Wada Y., Nosaka T., Kumagai H., Morikawa Y., Senba E.", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "reference": [ { "type": "PubMed", "id": "11123907", "url": "https://glygen.org/publication/PubMed/11123907" } ] }, { "title": "Intracellular trafficking of LRP9 is dependent on two acidic cluster/dileucine motifs.", "journal": "Histochemistry and cell biology", "date": "2008", "authors": "Boucher R, Larkin H, Brodeur J, Gagnon H, Theriault C, Lavoie C", "evidence": [ { "database": "RefSeq", "id": "NP_075369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369" } ], "reference": [ { "type": "PubMed", "id": "18461348", "url": "https://glygen.org/publication/PubMed/18461348" } ] }, { "title": "Calnuc binds to LRP9 and affects its endosomal sorting.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2009", "authors": "Brodeur J, Larkin H, Boucher R, Theriault C, St-Louis SC, Gagnon H, Lavoie C", "evidence": [ { "database": "RefSeq", "id": "NP_075369", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075369" } ], "reference": [ { "type": "PubMed", "id": "19497050", "url": "https://glygen.org/publication/PubMed/19497050" } ] } ], "pathway": [ { "id": "mmu:65107", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:65107", "resource": "KEGG Pathway" }, { "id": "R-MMU-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" } ], "orthologs": [ { "uniprot_canonical_ac": "F7F3K1-1", "protein_name": "LDL receptor related protein 10", "gene_name": "Lrp10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLSALPFLLLLLLGGALARPDRIPFLNSACEAPPAVLLEVQGTLQRPLGRDSRSSPANCTWVILGSKEQTVTVRFQKLHLACGSEHLILHSPLQPPVSLCEAPAGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCRSDPFPNPVPAPTPPCNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHYPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGTSGGRRRQRGRSVRRLVRRLRRWGLLPRTNTPARAPETRSQATPSVPSEALDDSTGQACEGGAVGGQDGEQAPPLPIKSPIPTPSTLPALATASEPPGPLPSVPVESSLLSGVVQVLRGRLLPSLWPPGPTWTPTGTHTAVLPLEDEDDVLLMPLAEPEVWVVEAEDEPLLA", "length": 712 }, "evidence": [ { "id": "45238061", "url": "http://www.informatics.jax.org/homology/45238061", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q7Z4F1-1", "protein_name": "Low-density lipoprotein receptor-related protein 10", "gene_name": "LRP10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLLATLLLLLLGGALAHPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGGPGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTPSAAPLEALDGGTGPAREGGAVGGQDGEQAPPLPIKAPLPSASTSPAPTTVPEAPGPLPSLPLEPSLLSGVVQALRGRLLPSLGPPGPTRSPPGPHTAVLALEDEDDVLLVPLAEPGVWVAEAEDEPLLT", "length": 713 }, "evidence": [ { "id": "45238061", "url": "http://www.informatics.jax.org/homology/45238061", "database": "MGI" }, { "id": "Q7TQH7", "url": "https://omabrowser.org/oma/group/Q7TQH7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" }, { "name": "clathrin-coated pit", "id": "GO:0005905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005905", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" }, { "name": "inner ear development", "id": "GO:0048839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048839", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "low-density lipoprotein particle receptor activity", "id": "GO:0005041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005041", "evidence": [ { "database": "UniProtKB", "id": "Q7TQH7", "url": "https://www.uniprot.org/uniprot/Q7TQH7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 112, "end_pos": 114, "annotation": "n_glycosylation_sequon" }, { "start_pos": 194, "end_pos": 196, "annotation": "n_glycosylation_sequon" }, { "start_pos": 300, "end_pos": 302, "annotation": "n_glycosylation_sequon" }, { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }