{ "uniprot_canonical_ac": "Q7TNN2-1", "uniprot_ac": "Q7TNN2", "uniprot_id": "COX8C_RAT", "mass": { "chemical_mass": 8073.0, "monoisotopic_mass": 8073.0 }, "refseq": { "ac": "NP_898878", "name": "cytochrome c oxidase subunit 8C, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878" }, "gene_names": [ { "name": "Cox8c", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q7TNN2", "id": "Q7TNN2" }, { "name": "COXVIII-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878", "id": "NP_898878" }, { "name": "Cox8c", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878", "id": "NP_898878" } ], "protein_names": [ { "name": "Cytochrome c oxidase subunit 8C, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q7TNN2" }, { "name": "COX VIII-3; cytochrome c oxidase subunit 8-3; cytochrome c oxidase polypeptide 8; cytochrome c oxidase polypeptide VIII; cytochrome c oxidase subunit VIII; cytochrome c oxidase, subunit VIIIc", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878", "id": "NP_898878" }, { "name": "COX VIII-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNN2" }, { "name": "Cytochrome c oxidase polypeptide 8 isoform 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNN2" }, { "name": "Cytochrome c oxidase polypeptide VIII isoform 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNN2" }, { "name": "Cytochrome c oxidase subunit 8-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNN2" }, { "name": "cytochrome c oxidase subunit 8C, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878", "id": "NP_898878" } ], "function": [ { "annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2#function" }, { "database": "UniProtKB", "id": "P10175", "url": "https://www.uniprot.org/uniprot/P10175#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cox8c", "url": "https://www.uniprot.org/uniprot/Q7TNN2", "locus": { "chromosome": "6", "start_pos": 122029889, "end_pos": 122028566, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000031106", "url": "https://www.ensembl.org/id/ENSRNOG00000031106" } ] } } ], "crossref": [ { "id": "ENSRNOG00000031106", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000031106", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "360229", "url": "https://www.ncbi.nlm.nih.gov/gene/360229", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003205", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003205", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036548", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036548", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:360229", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:360229", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "4842065at2759", "url": "http://www.orthodb.org/?query=4842065at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16717", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16717", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16717:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16717:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02285", "url": "http://pfam.xfam.org/family/PF02285", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q7TNN2", "url": "http://purl.obolibrary.org/obo/PR_Q7TNN2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_898878", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898878", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "727840", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=727840", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNN2-1", "url": "https://www.uniprot.org/uniprot/Q7TNN2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRLLQFCSSLLRHRVVLFSKPGHSGRLSHSESPQNQVLTPTESVVGIVVFFATFFIPAAYVMSNLKFFKGE", "length": 72, "header": "sp|Q7TNN2-1|COX8C_RAT Isoform 1 of Cytochrome c oxidase subunit 8C, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8c PE=3 SV=1 CANONICAL=Q7TNN2-1" }, "isoforms": [ { "isoform_ac": "Q7TNN2-1", "url": "", "sequence": { "sequence": "MSRLLQFCSSLLRHRVVLFSKPGHSGRLSHSESPQNQVLTPTESVVGIVVFFATFFIPAAYVMSNLKFFKGE", "length": 72, "header": "sp|Q7TNN2-1|COX8C_RAT Isoform 1 of Cytochrome c oxidase subunit 8C, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8c PE=3 SV=1 CANONICAL=Q7TNN2-1" }, "locus": { "chromosome": "6", "start_pos": 122029654, "end_pos": 122028666, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000052296", "url": "https://www.ensembl.org/id/ENSRNOT00000052296" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000047295", "url": "https://www.ensembl.org/id/ENSRNOP00000047295" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A third isoform of cytochrome c oxidase subunit VIII is present in mammals.", "journal": "Gene", "date": "2003", "authors": "Grossman L.I., Huettemann M., Schmidt T.R.", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "reference": [ { "type": "PubMed", "id": "12909344", "url": "https://glygen.org/publication/PubMed/12909344" } ] } ], "pathway": [ { "id": "rno:360229", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:360229", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6H666-1", "protein_name": "Cytochrome c oxidase subunit 8C, mitochondrial", "gene_name": "Cox8c", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSRLLLLCSSLLRHRAVLFSKPGHPGRLSHSESPQKKILSPTESAVGIVVFFTTFYIPAAYVLSSLKYFKGE", "length": 72 }, "evidence": [ { "id": "45240879", "url": "http://www.informatics.jax.org/homology/45240879", "database": "MGI" }, { "id": "Q7TNN2", "url": "https://omabrowser.org/oma/group/Q7TNN2/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7Z4L0-1", "protein_name": "Cytochrome c oxidase subunit 8C, mitochondrial", "gene_name": "COX8C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN", "length": 72 }, "evidence": [ { "id": "45240879", "url": "http://www.informatics.jax.org/homology/45240879", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "pmid": "" }, { "name": "respiratory chain complex IV", "id": "GO:0045277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045277", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex IV", "id": "GO:0005751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005751", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "Q7TNN2", "url": "https://www.uniprot.org/uniprot/Q7TNN2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }