{ "uniprot_canonical_ac": "Q7TNB2-1", "uniprot_ac": "Q7TNB2", "uniprot_id": "TNNT1_RAT", "mass": { "chemical_mass": 31215.0, "monoisotopic_mass": 31215.0 }, "refseq": { "ac": "NP_001264189", "name": "troponin T, slow skeletal muscle isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189" }, "gene_names": [ { "name": "Tnnt1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q7TNB2", "id": "Q7TNB2" }, { "name": "Fang2; sTnT; tnTs", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189", "id": "NP_001264189" }, { "name": "Fang2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7TNB2", "id": "Q7TNB2" }, { "name": "Tnnt1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189", "id": "NP_001264189" } ], "protein_names": [ { "name": "Troponin T, slow skeletal muscle", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q7TNB2" }, { "name": "Slow skeletal muscle troponin T", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNB2" }, { "name": "TnTs", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNB2" }, { "name": "sTnT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7TNB2" }, { "name": "troponin T, slow skeletal muscle isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189", "id": "NP_001264189" }, { "name": "troponin T, slow skeletal muscle; slow skeletal muscle troponin T; troponin T1, skeletal, slow; troponin T type 1 (skeletal, slow)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189", "id": "NP_001264189" } ], "function": [ { "annotation": "Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5YBH8", "url": "https://www.uniprot.org/uniprot/A0A8I5YBH8#function" }, { "database": "UniProtKB", "id": "ARBA00003363", "url": "https://www.uniprot.org/uniprot/ARBA00003363#function" }, { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2#function" } ] } ], "disease": [ { "disease_id": "DOID:0050700", "recommended_name": { "id": "DOID:0050700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050700", "name": "cardiomyopathy", "description": "A heart disease and a myopathy that is characterized by deterioration of the function of the heart muscle." }, "synonyms": [ { "id": "DOID:0050700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050700", "name": "Cardiomyopathies", "description": "" } ], "evidence": [ { "id": "0050700", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050700" } ] }, { "disease_id": "DOID:0060036", "recommended_name": { "id": "DOID:0060036", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060036", "name": "intrinsic cardiomyopathy", "description": "A cardiomyopathy that is characterized as weakness in the muscle of the heart that is not due to an identifiable external cause." }, "synonyms": [], "evidence": [ { "id": "0060036", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060036" } ] }, { "disease_id": "DOID:0081374", "recommended_name": { "id": "DOID:0081374", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081374", "name": "nemaline myopathy 5B", "description": "A nemaline myopathy that has_material_basis_in autosomal recessive inheritance of a homozygous or compound heterozygous mutation in the TNNT1 gene on chromosome 19q13, with childhood onset." }, "synonyms": [ { "id": "MONDO:0957281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0957281", "name": "nemaline myopathy 5B, autosomal recessive, childhood-onset", "description": "" } ], "evidence": [ { "id": "0081374", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081374" } ] }, { "disease_id": "DOID:0081375", "recommended_name": { "id": "DOID:0081375", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081375", "name": "nemaline myopathy 5C", "description": "A nemaline myopathy that has_material_basis_in autosomal dominant inheritance of a homozygous or compound heterozygous mutation in the TNNT1 gene on chromosome 19q13." }, "synonyms": [ { "id": "MONDO:0957284", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0957284", "name": "nemaline myopathy 5C, autosomal dominant", "description": "" } ], "evidence": [ { "id": "0081375", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0081375" } ] }, { "disease_id": "DOID:0110936", "recommended_name": { "id": "DOID:0110936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110936", "name": "nemaline myopathy 5A", "description": "A nemaline myopathy that has_material_basis_in autosomal recessive inheritance of a homozygous mutation in the TNNT1 gene on chromosome 19q13, with infantile onset." }, "synonyms": [ { "id": "DOID:0110936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110936", "name": "ANM", "description": "" }, { "id": "DOID:0110936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110936", "name": "Amish nemaline myopathy", "description": "" }, { "id": "DOID:0110936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110936", "name": "NEM5", "description": "" }, { "id": "DOID:0110936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110936", "name": "nemaline myopathy 5, Amish type", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy 5", "description": "Amish nemaline myopathy is a type of nemaline myopathy (NM) only observed in several families of the Amish community." }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "ANM", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "Amish nemaline myopathy", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "NEM5", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "TNNT1 nemaline myopathy", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy 5", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy 5, Amish type", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy caused by mutation in TNNT1", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy type 5", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy, Amish type", "description": "" }, { "id": "MONDO:0011539", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011539", "name": "nemaline myopathy, caused by mutation in the troponin t1 gene", "description": "" }, { "id": "MIM:605355", "resource": "MIM", "url": "https://www.omim.org/entry/605355", "name": "Nemaline myopathy 5", "description": "Nemaline myopathy 5" } ], "evidence": [ { "id": "0110936", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110936" } ] }, { "disease_id": "DOID:3191", "recommended_name": { "id": "DOID:3191", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3191", "name": "nemaline myopathy", "description": "A congenital myopathy characterized by generally non-progressive muscle weakness of varying severity and problems with the tone and contraction of skeletal muscles. The muscle cells contain abnormal clumps of threadlike material called nemaline bodies." }, "synonyms": [ { "id": "DOID:3191", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3191", "name": "Nemaline body disease", "description": "" }, { "id": "DOID:3191", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3191", "name": "nemaline rod myopathy", "description": "" }, { "id": "DOID:3191", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3191", "name": "rod myopathy", "description": "" }, { "id": "DOID:3191", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3191", "name": "rod body disease", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy 3", "description": "An inherited myopathy caused by mutations in the ACTA1 gene, encoding actin, alpha skeletal muscle. The phenotype is highly variable, and as such attempts at classification by clinical features is not optimal. Generally, affected individuals have generalized muscle weakness, typically involving proximal muscles, the face, bulbar and respiratory muscles." }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "ACTA1 nemaline myopathy", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "NEM3", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "actin myopathy", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "congenital myopathy with excess of thin filaments", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy 3", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy 3, autosomal dominant or recessive", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy caused by mutation in ACTA1", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy type 3", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "myopathy, actin, congenital, with Excess of thin myofilaments", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "myopathy, actin, congenital, with cores", "description": "" }, { "id": "MONDO:0008070", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008070", "name": "nemaline myopathy 3, with intranuclear rods", "description": "" }, { "id": "MIM:161800", "resource": "MIM", "url": "https://www.omim.org/entry/161800", "name": "Congenital myopathy 2A, typical, autosomal dominant", "description": "Congenital myopathy 2A, typical, autosomal dominant" } ], "evidence": [ { "id": "3191", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3191" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Tnnt1", "url": "https://www.uniprot.org/uniprot/Q7TNB2", "locus": { "chromosome": "1", "start_pos": 69316721, "end_pos": 69306362, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000028041", "url": "https://www.ensembl.org/id/ENSRNOG00000028041" } ] } } ], "crossref": [ { "id": "ENSRNOG00000028041", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000028041", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "171409", "url": "https://www.ncbi.nlm.nih.gov/gene/171409", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001978", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001978", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027707", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027707", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038077", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038077", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:171409", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:171409", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EWIYELE", "url": "https://omabrowser.org/oma/group/EWIYELE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5362548at2759", "url": "http://www.orthodb.org/?query=5362548at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11521", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11521", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11521:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11521:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00992", "url": "http://pfam.xfam.org/family/PF00992", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q7TNB2", "url": "http://purl.obolibrary.org/obo/PR_Q7TNB2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-390522", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390522", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001264189", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264189", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621852", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621852", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5YBH8", "url": "https://www.uniprot.org/uniprot/A0A8I5YBH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5YBH8-1", "url": "https://www.uniprot.org/uniprot/A0A8I5YBH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNB2-1", "url": "https://www.uniprot.org/uniprot/Q7TNB2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNB2-2", "url": "https://www.uniprot.org/uniprot/Q7TNB2-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNB2-3", "url": "https://www.uniprot.org/uniprot/Q7TNB2-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7TNB2-4", "url": "https://www.uniprot.org/uniprot/Q7TNB2-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 261, "header": "sp|Q7TNB2-1|TNNT1_RAT Isoform 1 of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3 CANONICAL=Q7TNB2-1" }, "isoforms": [ { "isoform_ac": "A0A8I5YBH8-1", "url": "", "sequence": { "sequence": "MQSGGAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 241, "header": "tr|A0A8I5YBH8-1|TNNT1_RAT Computationally mapped isoform of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=1 CANONICAL=Q7TNB2-1" }, "locus": { "chromosome": "1", "start_pos": 69316616, "end_pos": 69308154, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101852.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101852.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000076828.1", "url": "https://www.ensembl.org/id/ENSRNOP00000076828.1" } ] } }, { "isoform_ac": "Q7TNB2-1", "url": "", "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 261, "header": "sp|Q7TNB2-1|TNNT1_RAT Isoform 1 of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3 CANONICAL=Q7TNB2-1" }, "locus": { "chromosome": "1", "start_pos": 69316616, "end_pos": 69308115, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000034957", "url": "https://www.ensembl.org/id/ENSRNOT00000034957" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000038327", "url": "https://www.ensembl.org/id/ENSRNOP00000038327" } ] } }, { "isoform_ac": "Q7TNB2-2", "url": "", "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEAPEEPEPVAEREERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 260, "header": "sp|Q7TNB2-2|TNNT1_RAT Isoform 2 of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3 CANONICAL=Q7TNB2-1" }, "locus": {} }, { "isoform_ac": "Q7TNB2-3", "url": "", "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 249, "header": "sp|Q7TNB2-3|TNNT1_RAT Isoform 3 of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3 CANONICAL=Q7TNB2-1" }, "locus": {} }, { "isoform_ac": "Q7TNB2-4", "url": "", "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 250, "header": "sp|Q7TNB2-4|TNNT1_RAT Isoform 4 of Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3 CANONICAL=Q7TNB2-1" }, "locus": { "chromosome": "1", "start_pos": 69316616, "end_pos": 69308115, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000058843", "url": "https://www.ensembl.org/id/ENSRNOT00000058843" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000055633", "url": "https://www.ensembl.org/id/ENSRNOP00000055633" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Expression and functional properties of four slow skeletal troponin T isoforms in rat muscles.", "journal": "Am. J. Physiol.", "date": "2005", "authors": "Kischel P, Bastide B, Muller M, Dubail F, Offredi F, Jin JP, Mounier Y, Martial J", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "reference": [ { "type": "PubMed", "id": "15788488", "url": "https://glygen.org/publication/PubMed/15788488" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:171409", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:171409", "resource": "KEGG Pathway" }, { "id": "R-RNO-390522", "name": "Striated Muscle Contraction", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-390522", "resource": "Reactome", "description": "Striated Muscle Contraction" } ], "orthologs": [ { "uniprot_canonical_ac": "O88346-1", "protein_name": "Troponin T, slow skeletal muscle", "gene_name": "Tnnt1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 262 }, "evidence": [ { "id": "45234685", "url": "http://www.informatics.jax.org/homology/45234685", "database": "MGI" }, { "id": "Q7TNB2", "url": "https://omabrowser.org/oma/group/Q7TNB2/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P13805-1", "protein_name": "Troponin T, slow skeletal muscle", "gene_name": "TNNT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWLPPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK", "length": 278 }, "evidence": [ { "id": "45234685", "url": "http://www.informatics.jax.org/homology/45234685", "database": "MGI" }, { "id": "Q7TNB2", "url": "https://omabrowser.org/oma/group/Q7TNB2/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "regulation of muscle contraction", "id": "GO:0006937", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006937", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "skeletal muscle contraction", "id": "GO:0003009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003009", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "transition between fast and slow fiber", "id": "GO:0014883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014883", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "sarcomere organization", "id": "GO:0045214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045214", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "slow-twitch skeletal muscle fiber contraction", "id": "GO:0031444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031444", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "negative regulation of muscle contraction", "id": "GO:0045932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045932", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "troponin complex", "id": "GO:0005861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005861", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "troponin T binding", "id": "GO:0031014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031014", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" }, { "name": "tropomyosin binding", "id": "GO:0005523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005523", "evidence": [ { "database": "UniProtKB", "id": "Q7TNB2", "url": "https://www.uniprot.org/uniprot/Q7TNB2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }