{
    "uniprot_canonical_ac": "Q7M712-1",
    "uniprot_ac": "Q7M712",
    "uniprot_id": "TR110_MOUSE",
    "mass": {
        "chemical_mass": 37837.0,
        "monoisotopic_mass": 37837.0
    },
    "refseq": {
        "ac": "NP_954606",
        "name": "taste receptor type 2 member 110",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606"
    },
    "gene_names": [
        {
            "name": "Tas2r110",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q7M712",
            "id": "Q7M712"
        },
        {
            "name": "Tas2r110",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606",
            "id": "NP_954606"
        },
        {
            "name": "mt2r57; T2R10; Tas2r10",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606",
            "id": "NP_954606"
        }
    ],
    "protein_names": [
        {
            "name": "Taste receptor type 2 member 110",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q7M712"
        },
        {
            "name": "STC 9-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q7M712"
        },
        {
            "name": "T2R110",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606",
            "id": "NP_954606"
        },
        {
            "name": "T2R110",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q7M712"
        },
        {
            "name": "mT2r57",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q7M712"
        },
        {
            "name": "taste receptor type 2 member 110",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606",
            "id": "NP_954606"
        }
    ],
    "function": [
        {
            "annotation": "Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5 (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q7M712",
                    "url": "https://www.uniprot.org/uniprot/Q7M712#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q9JKE8",
                    "url": "https://www.uniprot.org/uniprot/Q9JKE8#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q7M712",
                    "url": "https://www.uniprot.org/uniprot/Q7M712"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Tas2r110",
            "url": "https://www.uniprot.org/uniprot/Q7M712",
            "locus": {
                "chromosome": "6",
                "start_pos": 132845972,
                "end_pos": 132844971,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000062952",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000062952"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd15019",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15019",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "387344",
            "url": "https://www.ncbi.nlm.nih.gov/gene/387344",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR007960",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007960",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:387344",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:387344",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "2681216",
            "url": "http://www.informatics.jax.org/marker/MGI:2681216",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "INIFCAV",
            "url": "https://omabrowser.org/oma/group/INIFCAV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5306466at2759",
            "url": "http://www.orthodb.org/?query=5306466at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11394",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11394",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11394:SF37",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11394:SF37",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF05296",
            "url": "http://pfam.xfam.org/family/PF05296",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q7M712",
            "url": "http://purl.obolibrary.org/obo/PR_Q7M712",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_954606",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_954606",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q7M712",
            "url": "https://www.uniprot.org/uniprot/Q7M712",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q7M712-1",
            "url": "https://www.uniprot.org/uniprot/Q7M712-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MFSQIISTSDIFTFTIILFVELVIGILGNGFIALVNIMDWTKRRSISSADQILTALAITRFLYVWFMIICILLFMLCPHLLTRSEIVTSIGIIWIVNNHFSVWLATCLGVFYFLKIANFSNSLFLYLKWRVKKVVLMIIQVSMIFLILNLLSLSMYDQFSIDVYEGNTSYNLGDSTPFPTISLFINSSKVFVITNSSHIFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKPPRDASTMAHIKALQTGFSFLLLYAVYLLFIVIGMLSLRLIGGKLILLFDHISGIGFPISHSFVLILGNNKLRQASLSVLHCLRCRSKDMDTMGP",
        "length": 333,
        "header": "sp|Q7M712-1|TR110_MOUSE Isoform 1 of Taste receptor type 2 member 110  OS=Mus musculus OX=10090 GN=Tas2r110 PE=3 SV=1 CANONICAL=Q7M712-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q7M712-1",
            "url": "",
            "sequence": {
                "sequence": "MFSQIISTSDIFTFTIILFVELVIGILGNGFIALVNIMDWTKRRSISSADQILTALAITRFLYVWFMIICILLFMLCPHLLTRSEIVTSIGIIWIVNNHFSVWLATCLGVFYFLKIANFSNSLFLYLKWRVKKVVLMIIQVSMIFLILNLLSLSMYDQFSIDVYEGNTSYNLGDSTPFPTISLFINSSKVFVITNSSHIFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKPPRDASTMAHIKALQTGFSFLLLYAVYLLFIVIGMLSLRLIGGKLILLFDHISGIGFPISHSFVLILGNNKLRQASLSVLHCLRCRSKDMDTMGP",
                "length": 333,
                "header": "sp|Q7M712-1|TR110_MOUSE Isoform 1 of Taste receptor type 2 member 110  OS=Mus musculus OX=10090 GN=Tas2r110 PE=3 SV=1 CANONICAL=Q7M712-1"
            },
            "locus": {
                "chromosome": "6",
                "start_pos": 132845969,
                "end_pos": 132844971,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000082014",
                        "url": "https://www.ensembl.org/id/ENSMUST00000082014"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000080674",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000080674"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 186,
            "start_aa": "Asn",
            "end_pos": 186,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn186",
            "evidence": [
                {
                    "id": "Q7M712",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q7M712#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 195,
            "start_aa": "Asn",
            "end_pos": 195,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn195",
            "evidence": [
                {
                    "id": "Q7M712",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q7M712#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Expression of bitter taste receptors of the T2R family in the gastrointestinal tract and enteroendocrine STC-1 cells.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2002",
            "authors": "Yang M., Wu S.V., Rozengurt E., Rozengurt N., Sinnett-Smith J., Young S.H.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q7M712",
                    "url": "https://www.uniprot.org/uniprot/Q7M712"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11854532",
                    "url": "https://glygen.org/publication/PubMed/11854532"
                }
            ]
        },
        {
            "title": "Adaptive diversification of bitter taste receptor genes in mammalian evolution.",
            "journal": "Mol. Biol. Evol.",
            "date": "2003",
            "authors": "Shi P, Zhang J, Yang H, Zhang YP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q7M712",
                    "url": "https://www.uniprot.org/uniprot/Q7M712"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12679530",
                    "url": "https://glygen.org/publication/PubMed/12679530"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:387344",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:387344",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q9JKE8-1",
            "protein_name": "Taste receptor type 2 member 110",
            "gene_name": "Tas2r110",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MFLHTIKQRDIFTLIIIFFVEITMGILGNGFIALVNIVDWIKRRRISSVDKILTTLALTRLIYAWSMLIFILLFILGPHLIMRSEILTSMGVIWVVNNHFSIWLATCLGVFYFLKIANFSNSLFLYLKWRVKKVVLMIIVVSLIFLILNIFSLEIYDHFSIDVYEGNMSYSLGDSTHFPRIFLFANSSKVFLITNSSQVFLPINSLFMLIPFTVSLVAFFMLIFSLWKHHKKMEVNAKGPRDASTTAHIKALQTGLSFLLLYAIYLLFIVIGILSHKFMGGKLILIFDHICAIVFPISHSFVLILGNSKLRRSTLSVLRFLRCRSKHIHIMDP",
                "length": 333
            },
            "evidence": [
                {
                    "id": "45227582",
                    "url": "http://www.informatics.jax.org/homology/45227582",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q9NYV8-1",
            "protein_name": "Taste receptor type 2 member 14",
            "gene_name": "TAS2R14",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVWLIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFLYLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS",
                "length": 317
            },
            "evidence": [
                {
                    "id": "45227582",
                    "url": "http://www.informatics.jax.org/homology/45227582",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7M712",
                                "url": "https://www.uniprot.org/uniprot/Q7M712"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "taste receptor activity",
                        "id": "GO:0008527",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008527",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7M712",
                                "url": "https://www.uniprot.org/uniprot/Q7M712"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "bitter taste receptor activity",
                        "id": "GO:0033038",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033038",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7M712",
                                "url": "https://www.uniprot.org/uniprot/Q7M712"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7M712",
                                "url": "https://www.uniprot.org/uniprot/Q7M712"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "detection of chemical stimulus involved in sensory perception of bitter taste",
                        "id": "GO:0001580",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001580",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q7M712",
                                "url": "https://www.uniprot.org/uniprot/Q7M712"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 118,
            "end_pos": 120,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 167,
            "end_pos": 169,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 186,
            "end_pos": 188,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 195,
            "end_pos": 197,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}