{ "uniprot_canonical_ac": "Q7M6Z3-1", "uniprot_ac": "Q7M6Z3", "uniprot_id": "SMYD2_RAT", "mass": { "chemical_mass": 49648.0, "monoisotopic_mass": 49648.0 }, "refseq": { "ac": "NP_996733", "name": "N-lysine methyltransferase SMYD2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733" }, "gene_names": [ { "name": "Smyd2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q7M6Z3", "id": "Q7M6Z3" }, { "name": "HSKM-B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733", "id": "NP_996733" }, { "name": "Smyd2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733", "id": "NP_996733" } ], "protein_names": [ { "name": "N-lysine methyltransferase SMYD2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q7M6Z3" }, { "name": "2.1.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7M6Z3" }, { "name": "2.1.1.354", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7M6Z3" }, { "name": "Histone methyltransferase SMYD2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7M6Z3" }, { "name": "N-lysine methyltransferase SMYD2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733", "id": "NP_996733" }, { "name": "SET and MYND domain-containing protein 2; histone methyltransferase SMYD2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733", "id": "NP_996733" }, { "name": "SET and MYND domain-containing protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7M6Z3" } ], "function": [ { "annotation": "LncRNA NEAT1 promotes cardiac hypertrophy through microRNA-19a-3p/SMYD2 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_996733", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733" }, { "database": "PubMed", "id": "32096186", "url": "https://glygen.org/publication/PubMed/32096186" } ] }, { "annotation": "Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'.", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3#function" }, { "database": "UniProtKB", "id": "Q9NRG4", "url": "https://www.uniprot.org/uniprot/Q9NRG4#function" } ] }, { "annotation": "SMYD2 glutathionylation is a novel molecular mechanism by which reactive oxygen species contribute to sarcomere destabilization. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_996733", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733" }, { "database": "PubMed", "id": "30337525", "url": "https://glygen.org/publication/PubMed/30337525" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "common_name": "Rat" } ], "gene": [ { "name": "Smyd2", "url": "https://www.uniprot.org/uniprot/Q7M6Z3", "locus": { "chromosome": "13", "start_pos": 101425273, "end_pos": 101466576, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003583", "url": "https://www.ensembl.org/id/ENSRNOG00000003583" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003583", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003583", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19202", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19202", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "289372", "url": "https://www.ncbi.nlm.nih.gov/gene/289372", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001214", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001214", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002893", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002893", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044419", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044419", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:289372", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289372", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HRIMDYL", "url": "https://omabrowser.org/oma/group/HRIMDYL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "166337at2759", "url": "http://www.orthodb.org/?query=166337at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12197", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12197", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12197:SF193", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12197:SF193", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00856", "url": "http://pfam.xfam.org/family/PF00856", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01753", "url": "http://pfam.xfam.org/family/PF01753", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q7M6Z3", "url": "http://purl.obolibrary.org/obo/PR_Q7M6Z3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6804760", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6804760", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_996733", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "727785", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=727785", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "51736", "url": "https://www.rhea-db.org/rhea/51736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "60260", "url": "https://www.rhea-db.org/rhea/60260", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7M6Z3-1", "url": "https://www.uniprot.org/uniprot/Q7M6Z3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVFGENWNPSETVRLTARILAKQKMHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEIRKLSNPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEIAHGKDHPYISEIKQEIESH", "length": 433, "header": "sp|Q7M6Z3-1|SMYD2_RAT Isoform 1 of N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1 CANONICAL=Q7M6Z3-1" }, "isoforms": [ { "isoform_ac": "Q7M6Z3-1", "url": "", "sequence": { "sequence": "MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVFGENWNPSETVRLTARILAKQKMHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEIRKLSNPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEIAHGKDHPYISEIKQEIESH", "length": 433, "header": "sp|Q7M6Z3-1|SMYD2_RAT Isoform 1 of N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1 CANONICAL=Q7M6Z3-1" }, "locus": { "chromosome": "13", "start_pos": 101466542, "end_pos": 101425515, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000004783", "url": "https://www.ensembl.org/id/ENSRNOT00000004783" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000004783", "url": "https://www.ensembl.org/id/ENSRNOP00000004783" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q7M6Z3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q7M6Z3" } ], "site_lbl": "Ser283" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Gene discovery in the hamster: a comparative genomics approach for gene annotation by sequencing of hamster testis cDNAs.", "journal": "BMC Genomics", "date": "2003", "authors": "Campbell J.L., Hendry W.J., Karri S., Khan S.A., Oduru S., Williams S.C.", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "reference": [ { "type": "PubMed", "id": "12783626", "url": "https://glygen.org/publication/PubMed/12783626" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" }, { "database": "iPTMnet", "id": "Q7M6Z3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q7M6Z3" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "SMYD2 glutathionylation contributes to degradation of sarcomeric proteins.", "journal": "Nature communications", "date": "2018", "authors": "Munkanatta Godage DNP, VanHecke GC, Samarasinghe KTG, Feng HZ, Hiske M, Holcomb J, Yang Z, Jin JP, Chung CS, Ahn YH", "evidence": [ { "database": "RefSeq", "id": "NP_996733", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733" } ], "reference": [ { "type": "PubMed", "id": "30337525", "url": "https://glygen.org/publication/PubMed/30337525" } ] }, { "title": "LncRNA NEAT1 promotes cardiac hypertrophy through microRNA-19a-3p/SMYD2 axis.", "journal": "European review for medical and pharmacological sciences", "date": "2020", "authors": "Sun XL, Lv JL, Dou L, Chen D, Zhu YC, Hu X", "evidence": [ { "database": "RefSeq", "id": "NP_996733", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_996733" } ], "reference": [ { "type": "PubMed", "id": "32096186", "url": "https://glygen.org/publication/PubMed/32096186" } ] } ], "pathway": [ { "id": "rno:289372", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289372", "resource": "KEGG Pathway" }, { "id": "R-RNO-3214841", "name": "PKMTs methylate histone lysines", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214841", "resource": "Reactome", "description": "PKMTs methylate histone lysines" }, { "id": "R-RNO-6804760", "name": "Regulation of TP53 Activity through Methylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6804760", "resource": "Reactome", "description": "Regulation of TP53 Activity through Methylation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8R5A0-1", "protein_name": "N-lysine methyltransferase SMYD2", "gene_name": "Smyd2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH", "length": 433 }, "evidence": [ { "id": "45227788", "url": "http://www.informatics.jax.org/homology/45227788", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NRG4-1", "protein_name": "N-lysine methyltransferase SMYD2", "gene_name": "SMYD2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH", "length": 433 }, "evidence": [ { "id": "45227788", "url": "http://www.informatics.jax.org/homology/45227788", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "regulation of DNA damage response, signal transduction by p53 class mediator", "id": "GO:0043516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043516", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "peptidyl-lysine monomethylation", "id": "GO:0018026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018026", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "peptidyl-lysine dimethylation", "id": "GO:0018027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018027", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "histone lysine methylation", "id": "GO:0034968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034968", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "RNA polymerase II complex binding", "id": "GO:0000993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000993", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "p53 binding", "id": "GO:0002039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002039", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "histone H3K36 methyltransferase activity", "id": "GO:0046975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046975", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "protein-lysine N-methyltransferase activity", "id": "GO:0016279", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016279", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" }, { "name": "histone H3K4 trimethyltransferase activity", "id": "GO:0140999", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140999", "evidence": [ { "database": "UniProtKB", "id": "Q7M6Z3", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 206, "end_pos": 208, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "51736", "name": "", "equation": "L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C6Y7-1", "D3ZSK5-1", "Q7M6Z3-1", "A0A0G2JTW4-1", "A0A0G2JW37-1", "D3ZEB9-1", "M0R767-1", "D4ADE5-1", "A0A8I6AL52-1", "Q8N6R0-5", "Q9NQV7-1", "Q9BYW2-1", "P0DPD7-4", "Q9NQR1-1", "Q9NRG4-1", "Q96AZ1-1", "Q8TBK2-1", "Q8WTS6-1", "Q91YR5-3", "Q96EQ9-1", "E9Q5F9-1", "P0DPE0-1", "D3YWP0-1", "Q9CWY3-1", "Q2YDW7-1", "Q8R5A0-1", "Q8VHL1-1", "Q54J80-1", "Q9VIK9-1" ], "evidence": [ { "id": "51736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/51736" } ] }, { "id": "60260", "name": "", "equation": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C6Y7-1", "Q7M6Z3-1", "Q9H7B4-1", "Q9NRG4-1", "Q9NQV7-1", "Q8NB12-1", "Q9CWR2-1", "Q8R5A0-1", "P97443-1", "Q96EQ9-1", "P38827-1", "Q54HS3-1", "Q5LJZ2-1", "Q8IRW8-1", "Q9VW15-1" ], "evidence": [ { "id": "60260", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/60260" } ] }, { "id": "R-RNO-3222237", "name": "SMYD2 methylates TP53", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7M6Z3-1" ], "evidence": [ { "id": "R-RNO-3222237", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3222237" } ] }, { "id": "R-RNO-4827383", "name": "WHSC1 (KMT3G), NSD1 (KMT3B), SMYD2 (KMT3C) methylate lysine-37 of histone H3 (H3K36)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7M6Z3-1" ], "evidence": [ { "id": "R-RNO-4827383", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4827383" } ] }, { "id": "R-RNO-5638157", "name": "WHSC1 (KMT3G), NSD1 (KMT3B), SMYD2 (KMT3C), ASH1L methylate methyl-lysine-37 of histone H3 (H3K36)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7M6Z3-1" ], "evidence": [ { "id": "R-RNO-5638157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5638157" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JTW4", "gene_name": "AABR07010705.1", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A0G2JTW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTW4" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A0G2JTW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTW4" } ] } ] }, { "uniprot_ac": "A0A0G2JW37", "gene_name": "RGD1561318", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A0G2JW37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW37" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A0G2JW37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW37" } ] } ] }, { "uniprot_ac": "A0A8I6AL52", "gene_name": "ENSRNOG00000067141", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A8I6AL52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AL52" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A8I6AL52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AL52" } ] } ] }, { "uniprot_ac": "D3YWP0", "gene_name": "Eef1akmt3", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D3YWP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YWP0" } ] } ] }, { "uniprot_ac": "D3ZEB9", "gene_name": "Kmt5a", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "D3ZEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEB9" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "D3ZEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEB9" } ] } ] }, { "uniprot_ac": "D3ZSK5", "gene_name": "Setd6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D3ZSK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSK5" } ] } ] }, { "uniprot_ac": "D4ADE5", "gene_name": "Setd7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] } ] }, { "uniprot_ac": "E9Q5F9", "gene_name": "Setd2", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] }, { "ec_number": "2.1.1.359", "activity": "", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] } ] }, { "uniprot_ac": "M0R767", "gene_name": "AABR07033047.1", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "M0R767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R767" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "M0R767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R767" } ] } ] }, { "uniprot_ac": "P0C6Y7", "gene_name": "Prdm9", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] } ] }, { "uniprot_ac": "P0DPD7", "gene_name": "EEF1AKMT4", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0DPD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ] } ] }, { "uniprot_ac": "P0DPE0", "gene_name": "Eef1akmt4", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0DPE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPE0" } ] } ] }, { "uniprot_ac": "P38827", "gene_name": "SET1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P38827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38827" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "P38827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38827" } ] } ] }, { "uniprot_ac": "P97443", "gene_name": "Smyd1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P97443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97443" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "P97443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97443" } ] } ] }, { "uniprot_ac": "Q2YDW7", "gene_name": "Kmt5a", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] } ] }, { "uniprot_ac": "Q54HS3", "gene_name": "set1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54HS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HS3" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q54HS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HS3" } ] } ] }, { "uniprot_ac": "Q54J80", "gene_name": "", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54J80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J80" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q54J80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J80" } ] } ] }, { "uniprot_ac": "Q5LJZ2", "gene_name": "Set1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q5LJZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5LJZ2" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q5LJZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5LJZ2" } ] } ] }, { "uniprot_ac": "Q7M6Z3", "gene_name": "Smyd2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q7M6Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q7M6Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ] } ] }, { "uniprot_ac": "Q8IRW8", "gene_name": "trr", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8IRW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IRW8" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q8IRW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IRW8" } ] } ] }, { "uniprot_ac": "Q8N6R0", "gene_name": "METTL13", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8N6R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6R0" } ] } ] }, { "uniprot_ac": "Q8NB12", "gene_name": "SMYD1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8NB12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NB12" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q8NB12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NB12" } ] } ] }, { "uniprot_ac": "Q8R5A0", "gene_name": "Smyd2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8R5A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5A0" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8R5A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5A0" } ] } ] }, { "uniprot_ac": "Q8TBK2", "gene_name": "SETD6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8TBK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TBK2" } ] } ] }, { "uniprot_ac": "Q8VHL1", "gene_name": "Setd7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8VHL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHL1" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8VHL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHL1" } ] } ] }, { "uniprot_ac": "Q8WTS6", "gene_name": "SETD7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] } ] }, { "uniprot_ac": "Q91YR5", "gene_name": "Mettl13", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q91YR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YR5" } ] } ] }, { "uniprot_ac": "Q96AZ1", "gene_name": "EEF1AKMT3", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q96AZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AZ1" } ] } ] }, { "uniprot_ac": "Q96EQ9", "gene_name": "Prdm9", "activity": [ { "ec_number": "2.1.1.43", "activity": "", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] } ] }, { "uniprot_ac": "Q9BYW2", "gene_name": "SETD2", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] }, { "ec_number": "2.1.1.359", "activity": "", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] } ] }, { "uniprot_ac": "Q9CWR2", "gene_name": "Smyd3", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9CWR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWR2" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q9CWR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWR2" } ] } ] }, { "uniprot_ac": "Q9CWY3", "gene_name": "Setd6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9CWY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWY3" } ] } ] }, { "uniprot_ac": "Q9H7B4", "gene_name": "SMYD3", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9H7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7B4" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q9H7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H7B4" } ] } ] }, { "uniprot_ac": "Q9NQR1", "gene_name": "KMT5A", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] } ] }, { "uniprot_ac": "Q9NQV7", "gene_name": "PRDM9", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] } ] }, { "uniprot_ac": "Q9NRG4", "gene_name": "SMYD2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NRG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRG4" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NRG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRG4" } ] } ] }, { "uniprot_ac": "Q9VIK9", "gene_name": "", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9VIK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIK9" } ] } ] }, { "uniprot_ac": "Q9VW15", "gene_name": "ash1", "activity": [ { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9VW15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW15" } ] }, { "ec_number": "2.1.1.354", "activity": "", "evidence": [ { "id": "Q9VW15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW15" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }