{ "uniprot_canonical_ac": "Q7KGG1-1", "uniprot_ac": "Q7KGG1", "uniprot_id": "Q7KGG1_DROME", "mass": { "chemical_mass": 62305.0, "monoisotopic_mass": 62305.0 }, "refseq": { "ac": "NP_610977", "name": "adenosine deaminase-related growth factor E", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977" }, "gene_names": [ { "name": "Adgf-E", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "ADGF-E; adgfe; CG10143; Dmel\\CG10143", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977", "id": "NP_610977" }, { "name": "ADGF-E", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "Adgf-E-RA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "Adgf-E", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977", "id": "NP_610977" }, { "name": "CG10143", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "Dmel\\CG10143", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "Dmel_CG10143", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" }, { "name": "adgfe", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "id": "Q7KGG1" } ], "protein_names": [ { "name": "adenosine deaminase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q7KGG1" }, { "name": "3.5.4.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q7KGG1" }, { "name": "CG10143-PA; Adgf-E-PA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977", "id": "NP_610977" }, { "name": "adenosine deaminase-related growth factor E", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977", "id": "NP_610977" } ], "function": [], "disease": [ { "disease_id": "DOID:106", "recommended_name": { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "pleural tuberculosis", "description": "An extrapulmonary tuberculosis that results_in lymphocyte-predominant exudative pleural effusion, located_in pleura. This results from an allergic response to tuberculoprotein causing the permeabiltity of the pleural vasculature to alter leading to a sub-pleural caseous focus rupture into the pleural sac." }, "synonyms": [ { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Pearly disease", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculosis of pleura", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculous pleurisy", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "Tuberculous pleuritis", "description": "" }, { "id": "DOID:106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:106", "name": "tuberculous pleurisy in primary progressive tuberculosis", "description": "" } ], "evidence": [ { "id": "106", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:106" } ] }, { "disease_id": "DOID:13096", "recommended_name": { "id": "DOID:13096", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13096", "name": "Sneddon syndrome", "description": "An artery disease that is characterized by onset of livedo reticularis in the second decade and onset of cerebrovascular disease in early adulthood and that has_material_basis_in compound heterozygous mutation in the CECR1 gene (ADA2) on chromosome 22q11." }, "synonyms": [ { "id": "DOID:13096", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13096", "name": "Idiopathic livedo reticularis with systemic involvement", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "Sneddon syndrome", "description": "Sneddon's syndrome (SS) is a rare non-inflammatory thrombotic vasculopathy characterized by the combination of cerebrovascular disease with livedo racemosa." }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "Ehrmann-Sneddon syndrome", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "Sneddon syndrome", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "idiopathic livedo reticularis with systemic involvement", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "livedo racemosa-cerebrovascular accident syndrome", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "livedo reticularis-cerebrovascular accident syndrome", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "Sneddon's syndrome", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "cerebro-vascular lesions and livedo reticularis", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "livedo racemosa and cerebrovascular accidents", "description": "" }, { "id": "MONDO:0008436", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008436", "name": "livedo reticularis and cerebrovascular accidents", "description": "" }, { "id": "MIM:182410", "resource": "MIM", "url": "https://www.omim.org/entry/182410", "name": "Sneddon syndrome", "description": "Sneddon syndrome" } ], "evidence": [ { "id": "13096", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13096" } ] }, { "disease_id": "DOID:2957", "recommended_name": { "id": "DOID:2957", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2957", "name": "pulmonary tuberculosis", "description": "A tuberculosis that is a contagious disease located_in lungs. The infection has_symptom fever, has_symptom cough, has_symptom difficulty in breathing, has_symptom inflammatory infiltrations, has_symptom formation of tubercles, has_symptom caseation, has_symptom pleural effusion, and has_symptom fibrosis." }, "synonyms": [], "evidence": [ { "id": "2957", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2957" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Adgf-E", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "locus": { "chromosome": "2R", "start_pos": 14656798, "end_pos": 14658755, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0033952", "url": "https://www.ensembl.org/id/FBgn0033952" } ] } } ], "crossref": [ { "id": "FBgn0033952", "url": "https://bgee.org/?page=gene&gene_id=FBgn0033952", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01321", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01321", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0033952", "url": "https://flybase.org/reports/FBgn0033952", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "36627", "url": "https://www.ncbi.nlm.nih.gov/gene/36627", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001365", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001365", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006330", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006330", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006331", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006331", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013659", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013659", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032466", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032466", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG10143", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10143", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GHGYTIT", "url": "https://omabrowser.org/oma/group/GHGYTIT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4403at2759", "url": "http://www.orthodb.org/?query=4403at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11409", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11409", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11409:SF39", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11409:SF39", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00962", "url": "http://pfam.xfam.org/family/PF00962", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08451", "url": "http://pfam.xfam.org/family/PF08451", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_610977", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_610977", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "24408", "url": "https://www.rhea-db.org/rhea/24408", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7KGG1-1", "url": "https://www.uniprot.org/uniprot/Q7KGG1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTVLLSHRMLLAGWARRATPTAAQWIHHNPEKMTLLEMLGTTNLRKSTPKDYRILREIFNSFERYSGVGNDIQLTLPERAANELIMCEKKREYEKGIMDPSKFAPGHHIFQVLTKVKKSPLFQILRRMPKGAALKAHDTSMCSSRVVIEITYRDNLWVCTTQNGCRVEEFRFAKDKPKDVSFENGEWQPMEKLRELRGEENLRKYLQMRFSMYPLASFTTNAHAWRHMMGIFGLLDGLLQYAPVWGDYYYNALKEFYADGVQYLEVRSVLPQLYSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELNKEFPSFVVGFDLVGQEDVGHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSHVDQNLLDAIVLGTKRIGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHDFYMAFLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEKWKKQWDKWVENIVRQRKKDSETEKK", "length": 539, "header": "tr|Q7KGG1-1|Q7KGG1_DROME Isoform 1 of adenosine deaminase OS=Drosophila melanogaster OX=7227 GN=Adgf-E PE=2 SV=1 CANONICAL=Q7KGG1-1" }, "isoforms": [ { "isoform_ac": "Q7KGG1-1", "url": "", "sequence": { "sequence": "MTVLLSHRMLLAGWARRATPTAAQWIHHNPEKMTLLEMLGTTNLRKSTPKDYRILREIFNSFERYSGVGNDIQLTLPERAANELIMCEKKREYEKGIMDPSKFAPGHHIFQVLTKVKKSPLFQILRRMPKGAALKAHDTSMCSSRVVIEITYRDNLWVCTTQNGCRVEEFRFAKDKPKDVSFENGEWQPMEKLRELRGEENLRKYLQMRFSMYPLASFTTNAHAWRHMMGIFGLLDGLLQYAPVWGDYYYNALKEFYADGVQYLEVRSVLPQLYSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELNKEFPSFVVGFDLVGQEDVGHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSHVDQNLLDAIVLGTKRIGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHDFYMAFLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEKWKKQWDKWVENIVRQRKKDSETEKK", "length": 539, "header": "tr|Q7KGG1-1|Q7KGG1_DROME Isoform 1 of adenosine deaminase OS=Drosophila melanogaster OX=7227 GN=Adgf-E PE=2 SV=1 CANONICAL=Q7KGG1-1" }, "locus": { "chromosome": "2R", "start_pos": 14658665, "end_pos": 14656882, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0087482", "url": "https://www.ensembl.org/id/FBtr0087482" }, { "database": "Ensembl Peptide", "id": "FBpp0086611", "url": "https://www.ensembl.org/id/FBpp0086611" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Characterization of the adenosine deaminase-related growth factor (ADGF) gene family in Drosophila.", "journal": "Gene", "date": "2001", "authors": "McDermid H.E., Maier S.A., Locke J., Podemski L., Graham S.W.", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "11738815", "url": "https://glygen.org/publication/PubMed/11738815" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG10143", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG10143", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "inosine biosynthetic process", "id": "GO:0046103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046103", "evidence": [ { "database": "UniProtKB", "id": "Q7KGG1", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "24408", "name": "", "equation": "adenosine + H(+) + H2O = inosine + NH4(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q920P6-1", "P00813-1", "Q9NZK5-1", "Q8IV20-1", "P03958-1", "Q8BZT9-1", "Q553U5-1", "Q54KF3-1", "Q8IQR3-1", "Q9VVK5-1", "Q9VFS1-1", "Q7KGG1-1", "Q9VFS0-1", "Q9VVK4-1" ], "evidence": [ { "id": "24408", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24408" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P00813", "gene_name": "ADA", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "P00813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00813" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "P00813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00813" } ] } ] }, { "uniprot_ac": "P03958", "gene_name": "Ada", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "P03958", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03958" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "P03958", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03958" } ] } ] }, { "uniprot_ac": "Q54KF3", "gene_name": "ada", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q54KF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KF3" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q54KF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54KF3" } ] } ] }, { "uniprot_ac": "Q553U5", "gene_name": "ADA2", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q553U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553U5" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q553U5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553U5" } ] } ] }, { "uniprot_ac": "Q7KGG1", "gene_name": "Adgf-E", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q7KGG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q7KGG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KGG1" } ] } ] }, { "uniprot_ac": "Q8BZT9", "gene_name": "Lacc1", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] } ] }, { "uniprot_ac": "Q8IQR3", "gene_name": "Adgf-A2", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q8IQR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQR3" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q8IQR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQR3" } ] } ] }, { "uniprot_ac": "Q8IV20", "gene_name": "LACC1", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] } ] }, { "uniprot_ac": "Q920P6", "gene_name": "Ada", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q920P6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P6" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q920P6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P6" } ] } ] }, { "uniprot_ac": "Q9NZK5", "gene_name": "ADA2", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9NZK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZK5" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9NZK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZK5" } ] } ] }, { "uniprot_ac": "Q9VFS0", "gene_name": "Adgf-C", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9VFS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFS0" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9VFS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFS0" } ] } ] }, { "uniprot_ac": "Q9VFS1", "gene_name": "Adgf-D", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9VFS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFS1" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9VFS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFS1" } ] } ] }, { "uniprot_ac": "Q9VVK4", "gene_name": "Adgf-B", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9VVK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK4" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9VVK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK4" } ] } ] }, { "uniprot_ac": "Q9VVK5", "gene_name": "Adgf-A", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q9VVK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK5" } ] }, { "ec_number": "3.5.4.4", "activity": "", "evidence": [ { "id": "Q9VVK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVK5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }