{ "uniprot_canonical_ac": "Q792Q4-1", "uniprot_ac": "Q792Q4", "uniprot_id": "CRIPT_RAT", "mass": { "chemical_mass": 11271.0, "monoisotopic_mass": 11271.0 }, "refseq": { "ac": "NP_063972", "name": "cysteine-rich PDZ-binding protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972" }, "gene_names": [ { "name": "Cript", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q792Q4", "id": "Q792Q4" }, { "name": "Cript", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972", "id": "NP_063972" } ], "protein_names": [ { "name": "Cysteine-rich PDZ-binding protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q792Q4" }, { "name": "Cysteine-rich interactor of PDZ three", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q792Q4" }, { "name": "Cysteine-rich interactor of PDZ3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q792Q4" }, { "name": "cysteine-rich PDZ-binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972", "id": "NP_063972" }, { "name": "cysteine-rich interactor of PDZ3; cysteine-rich interactor of PDZ three; postsynaptic protein Cript", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972", "id": "NP_063972" } ], "function": [ { "annotation": "As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (By similarity). Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses (PubMed:9581762, PubMed:10570482).", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4#function" }, { "database": "PubMed", "id": "10570482", "url": "https://glygen.org/publication/PubMed/10570482" }, { "database": "PubMed", "id": "9581762", "url": "https://glygen.org/publication/PubMed/9581762" }, { "database": "UniProtKB", "id": "Q9P021", "url": "https://www.uniprot.org/uniprot/Q9P021#function" } ] }, { "annotation": "Interaction Between CRIPT and PSD-95 Is Required for Proper Dendritic Arborization in Hippocampal Neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_063972", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972" }, { "database": "PubMed", "id": "32157575", "url": "https://glygen.org/publication/PubMed/32157575" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 100, "end_pos": 100, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with DLG4. Strongly abolishes interaction with DLG4; when associated with E-98.", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" }, { "database": "PubMed", "id": "9581762", "url": "https://glygen.org/publication/PubMed/9581762" } ] }, { "start_pos": 101, "end_pos": 101, "sequence_org": "V", "sequence_mut": "A", "comment": "Abolishes interaction with DLG4. Does not redistribute DLG4 to microtubules. Associates with microtubules.", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" }, { "database": "PubMed", "id": "10570482", "url": "https://glygen.org/publication/PubMed/10570482" }, { "database": "PubMed", "id": "9581762", "url": "https://glygen.org/publication/PubMed/9581762" } ] }, { "start_pos": 98, "end_pos": 98, "sequence_org": "Q", "sequence_mut": "E", "comment": "Abolishes interaction with DLG4. Strongly abolishes interaction with DLG4; when associated with D-100.", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" }, { "database": "PubMed", "id": "9581762", "url": "https://glygen.org/publication/PubMed/9581762" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cript", "url": "https://www.uniprot.org/uniprot/Q792Q4", "locus": { "chromosome": "6", "start_pos": 7580703, "end_pos": 7589399, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000015215", "url": "https://www.ensembl.org/id/ENSRNOG00000015215" } ] } } ], "crossref": [ { "id": "ENSRNOG00000015215", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000015215", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "56725", "url": "https://www.ncbi.nlm.nih.gov/gene/56725", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q792Q4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q792Q4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:56725", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:56725", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ICKQQLH", "url": "https://omabrowser.org/oma/group/ICKQQLH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "45153at2759", "url": "http://www.orthodb.org/?query=45153at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11805", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11805", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11805:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11805:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5HEB", "url": "https://www.rcsb.org/structure/5HEB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HED", "url": "https://www.rcsb.org/structure/5HED", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HEY", "url": "https://www.rcsb.org/structure/5HEY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HF1", "url": "https://www.rcsb.org/structure/5HF1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HFB", "url": "https://www.rcsb.org/structure/5HFB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HFC", "url": "https://www.rcsb.org/structure/5HFC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HFE", "url": "https://www.rcsb.org/structure/5HFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HFF", "url": "https://www.rcsb.org/structure/5HFF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF10235", "url": "http://pfam.xfam.org/family/PF10235", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q792Q4", "url": "http://purl.obolibrary.org/obo/PR_Q792Q4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_063972", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621545", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621545", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AVC2", "url": "https://www.uniprot.org/uniprot/A0A8I6AVC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AVC2-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AVC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q792Q4-1", "url": "https://www.uniprot.org/uniprot/Q792Q4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV", "length": 101, "header": "sp|Q792Q4-1|CRIPT_RAT Isoform 1 of Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=1 SV=1 CANONICAL=Q792Q4-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AVC2-1", "url": "", "sequence": { "sequence": "YVCQNCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV", "length": 101, "header": "tr|A0A8I6AVC2-1|A0A8I6AVC2_RAT Computationally mapped isoform of Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=3 SV=1 CANONICAL=Q792Q4-1" }, "locus": { "chromosome": "6", "start_pos": 7587117, "end_pos": 7582485, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000113445.1", "url": "https://www.ensembl.org/id/ENSRNOT00000113445.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097693.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097693.1" } ] } }, { "isoform_ac": "Q792Q4-1", "url": "", "sequence": { "sequence": "MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV", "length": 101, "header": "sp|Q792Q4-1|CRIPT_RAT Isoform 1 of Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=1 SV=1 CANONICAL=Q792Q4-1" }, "locus": { "chromosome": "6", "start_pos": 7589321, "end_pos": 7582485, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000020534", "url": "https://www.ensembl.org/id/ENSRNOT00000020534" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000020534", "url": "https://www.ensembl.org/id/ENSRNOP00000020534" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Microtubule binding by CRIPT and its potential role in the synaptic clustering of PSD-95.", "journal": "Nat. Neurosci.", "date": "1999", "authors": "Passafaro M, Sala C, Niethammer M, Sheng M", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "reference": [ { "type": "PubMed", "id": "10570482", "url": "https://glygen.org/publication/PubMed/10570482" } ] }, { "title": "Interaction Between CRIPT and PSD-95 Is Required for Proper Dendritic Arborization in Hippocampal Neurons.", "journal": "Molecular neurobiology", "date": "2020", "authors": "Omelchenko A, Menon H, Donofrio SG, Kumar G, Chapman HM, Roshal J, Martinez-Montes ER, Wang TL, Spaller MR, Firestein BL", "evidence": [ { "database": "RefSeq", "id": "NP_063972", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_063972" } ], "reference": [ { "type": "PubMed", "id": "32157575", "url": "https://glygen.org/publication/PubMed/32157575" } ] }, { "title": "CRIPT, a novel postsynaptic protein that binds to the third PDZ domain of PSD-95/SAP90.", "journal": "Neuron", "date": "1998", "authors": "Niethammer M, Valtschanoff JG, Kapoor TM, Allison DW, Weinberg RJ, Craig AM, Sheng M", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "reference": [ { "type": "PubMed", "id": "9581762", "url": "https://glygen.org/publication/PubMed/9581762" } ] } ], "pathway": [ { "id": "rno:56725", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:56725", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O70333-1", "protein_name": "Cysteine-rich PDZ-binding protein", "gene_name": "Cript", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV", "length": 101 }, "evidence": [ { "id": "45239006", "url": "http://www.informatics.jax.org/homology/45239006", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9P021-1", "protein_name": "Cysteine-rich PDZ-binding protein", "gene_name": "CRIPT", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV", "length": 101 }, "evidence": [ { "id": "45239006", "url": "http://www.informatics.jax.org/homology/45239006", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "dendritic shaft", "id": "GO:0043198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043198", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "spliceosomal complex", "id": "GO:0005681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005681", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "postsynaptic density, intracellular component", "id": "GO:0099092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099092", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "cytoplasmic microtubule organization", "id": "GO:0031122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031122", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "regulation of postsynaptic density protein 95 clustering", "id": "GO:1902897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902897", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "protein localization to microtubule", "id": "GO:0035372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035372", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "regulation of postsynaptic density assembly", "id": "GO:0099151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099151", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "PDZ domain binding", "id": "GO:0030165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030165", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "Q792Q4", "url": "https://www.uniprot.org/uniprot/Q792Q4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }