{ "uniprot_canonical_ac": "Q76NW2-1", "uniprot_ac": "Q76NW2", "uniprot_id": "H4_DICDI", "mass": { "chemical_mass": 12017.0, "monoisotopic_mass": 12017.0 }, "refseq": { "ac": "XP_642712", "name": "histone H4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642712" }, "gene_names": [ { "name": "H4a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q76NW2", "id": "Q76NW2" }, { "name": "H4b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q76NW2", "id": "Q76NW2" }, { "name": "DDB_G0276863", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q76NW2", "id": "Q76NW2" }, { "name": "DDB_G0277183", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q76NW2", "id": "Q76NW2" }, { "name": "H4a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642712", "id": "XP_642712" } ], "protein_names": [ { "name": "Histone H4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q76NW2" }, { "name": "histone H4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642712", "id": "XP_642712" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "H4a", "url": "https://www.uniprot.org/uniprot/Q76NW2", "locus": {} } ], "crossref": [ { "id": "cd00076", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00076", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0276863", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "DDB_G0277183", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8620827", "url": "https://www.ncbi.nlm.nih.gov/gene/8620827", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8620904", "url": "https://www.ncbi.nlm.nih.gov/gene/8620904", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001951", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001951", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035425", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035425", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0276863", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0276863", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ddi:DDB_G0277183", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277183", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QKEHING", "url": "https://omabrowser.org/oma/group/QKEHING/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR10484", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10484", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10484:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10484:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15511", "url": "http://pfam.xfam.org/family/PF15511", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q76NW2", "url": "http://purl.obolibrary.org/obo/PR_Q76NW2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2299718", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214847", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-4551638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_642712", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_642712", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q76NW2-1", "url": "https://www.uniprot.org/uniprot/Q76NW2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSAQSRGGKTGGKVGGKVGAKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTEHAGRRTVTAMDVVYALKRQGRTLYGFNS", "length": 108, "header": "sp|Q76NW2-1|H4_DICDI Isoform 1 of Histone H4 OS=Dictyostelium discoideum OX=44689 GN=H4a PE=1 SV=1 CANONICAL=Q76NW2-1" }, "isoforms": [ { "isoform_ac": "Q76NW2-1", "url": "", "sequence": { "sequence": "MSSAQSRGGKTGGKVGGKVGAKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTEHAGRRTVTAMDVVYALKRQGRTLYGFNS", "length": 108, "header": "sp|Q76NW2-1|H4_DICDI Isoform 1 of Histone H4 OS=Dictyostelium discoideum OX=44689 GN=H4a PE=1 SV=1 CANONICAL=Q76NW2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gloeckner G., Kumpf K., Lehmann R., Platzer M., Rosenthal A., Bankier A.T., Dear P.H., Szafranski K., Guigo R., Parra G., Noegel A.A., Glockner G., Tunggal B., Abril J.F., Cox E., Eichinger L., Quail M.A., Cox E.C., Baumgart C., Pachebat J.A.", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Purification and the histones of Dictyostelium discoideum chromatin.", "journal": "Biochemistry", "date": "1979", "authors": "Bonner J., Bakke A.C.", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "reference": [ { "type": "PubMed", "id": "497154", "url": "https://glygen.org/publication/PubMed/497154" } ] } ], "pathway": [ { "id": "ddi:DDB_G0276863", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0276863", "resource": "KEGG Pathway" }, { "id": "ddi:DDB_G0277183", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0277183", "resource": "KEGG Pathway" }, { "id": "R-DDI-2299718", "name": "Condensation of Prophase Chromosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2299718", "resource": "Reactome", "description": "Condensation of Prophase Chromosomes" }, { "id": "R-DDI-3214847", "name": "HATs acetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214847", "resource": "Reactome", "description": "HATs acetylate histones" }, { "id": "R-DDI-3214858", "name": "RMTs methylate histone arginines", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-DDI-4551638", "name": "SUMOylation of chromatin organization proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-4551638", "resource": "Reactome", "description": "SUMOylation of chromatin organization proteins" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" }, { "name": "response to mercury ion", "id": "GO:0046689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046689", "evidence": [ { "database": "UniProtKB", "id": "Q76NW2", "url": "https://www.uniprot.org/uniprot/Q76NW2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }