{ "uniprot_canonical_ac": "Q71S46-1", "uniprot_ac": "Q71S46", "uniprot_id": "AT5G3_RAT", "mass": { "chemical_mass": 14693.0, "monoisotopic_mass": 14693.0 }, "refseq": {}, "gene_names": [ { "name": "Atp5mc3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q71S46", "id": "Q71S46" }, { "name": "Atp5g3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q71S46", "id": "Q71S46" } ], "protein_names": [ { "name": "ATP synthase F(0) complex subunit C3, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q71S46" }, { "name": "ATP synthase lipid-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q71S46" }, { "name": "ATP synthase membrane subunit c locus 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q71S46" }, { "name": "ATP synthase proteolipid P3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q71S46" }, { "name": "ATPase protein 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q71S46" }, { "name": "ATPase subunit c", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q71S46" } ], "function": [ { "annotation": "Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.", "evidence": [ { "database": "UniProtKB", "id": "Q499S2", "url": "https://www.uniprot.org/uniprot/Q499S2#function" }, { "database": "UniProtKB", "id": "ARBA00003897", "url": "https://www.uniprot.org/uniprot/ARBA00003897#function" }, { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46#function" }, { "database": "UniProtKB", "id": "F7EW45", "url": "https://www.uniprot.org/uniprot/F7EW45#function" } ] } ], "disease": [ { "disease_id": "DOID:0070445", "recommended_name": { "id": "DOID:0070445", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070445", "name": "early-onset dystonia and/or spastic paraplegia", "description": "A dystonia characterized by variable onset of dystonia, spasticity, or both that has_material_basis_in heterozygous mutation in the ATP5MC3 gene on chromosome 2q31.1." }, "synonyms": [ { "id": "MONDO:0859215", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859215", "name": "dystonia, early-onset, and/or spastic paraplegia", "description": "" }, { "id": "MIM:619681", "resource": "MIM", "url": "https://www.omim.org/entry/619681", "name": "Dystonia, early-onset, and/or spastic paraplegia", "description": "Dystonia, early-onset, and/or spastic paraplegia" } ], "evidence": [ { "id": "0070445", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070445" } ] }, { "disease_id": "DOID:0111143", "recommended_name": { "id": "DOID:0111143", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111143", "name": "mitochondrial complex V (ATP synthase) deficiency", "description": "A mitochondrial metabolism disease characterized by impaired function of one or more of the proteins making up the mitochondrial proton-transporting ATP synthase complex." }, "synonyms": [], "evidence": [ { "id": "0111143", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111143" } ] }, { "disease_id": "DOID:2476", "recommended_name": { "id": "DOID:2476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2476", "name": "hereditary spastic paraplegia", "description": "A paraplegia that is characterized by progressive stiffness and contraction (spasticity) in the lower limbs." }, "synonyms": [ { "id": "DOID:2476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2476", "name": "French settlement disease", "description": "" }, { "id": "DOID:2476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2476", "name": "Strumpell-Lorrain disease", "description": "" }, { "id": "DOID:2476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2476", "name": "familial spastic paraplegia", "description": "" }, { "id": "DOID:2476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2476", "name": "hereditary spastic paraparesis", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "MASA syndrome", "description": "MASA syndrome (Mental retardation, Aphasia, Spastic paraplegia, Adducted thumbs) is a historical term used to describe a phenotype now considered to be part of the X-linked L1 clinical spectrum (L1 syndrome). MASA is characterized by mild to moderate intellectual deficit, delayed development of speech, hypotonia progressing to spasticity or spastic paraplegia, adducted thumbs, and mild to moderate distension of the cerebral ventricles." }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "Gareis-Mason syndrome", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "MASA syndrome", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "X-linked complicated hereditary spastic paraplegia type 1", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "X-linked corpus callosum agenesis", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "X-linked spastic paraplegia 1", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "hereditary spastic paraplegia 1", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "intellectual disability-aphasia-shuffling gait-adducted thumbs syndrome", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "masa syndrome, X-linked recessive", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "spastic paraplegia, X-linked", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "CRASH syndrome", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "CRASH syndrome, X-linked recessive", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "Clasped thumb and intellectual disability", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "Clasped thumb and mental retardation", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "adducted thumb with intellectual disability", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "adducted thumb with mental retardation", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "intellectual disability aphasia shuffling Gait adducted thumbs (MASA)", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "intellectual disability, aphasia, shuffling Gait, and adducted thumbs", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "mental retardation aphasia shuffling Gait adducted thumbs (MASA)", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "mental retardation, aphasia, shuffling Gait, and adducted thumbs", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "spastic paraplegia 1", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "spastic paraplegia 1, X-linked", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "thumb congenital clasped with intellectual disability", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "thumb congenital clasped with mental retardation", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "thumb, congenital Clasped, with intellectual disability", "description": "" }, { "id": "MONDO:0010559", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010559", "name": "thumb, congenital Clasped, with mental retardation", "description": "" }, { "id": "MIM:303350", "resource": "MIM", "url": "https://www.omim.org/entry/303350", "name": "MASA syndrome", "description": "MASA syndrome" } ], "evidence": [ { "id": "2476", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2476" } ] }, { "disease_id": "DOID:543", "recommended_name": { "id": "DOID:543", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:543", "name": "dystonia", "description": "A movement disease that is characterized by involuntary muscle contractions causing repetitive or twisting movements." }, "synonyms": [ { "id": "DOID:543", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:543", "name": "dystonic disease", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset generalized limb-onset dystonia", "description": "A rare movement disorder characterized by involuntary, repetitive, sustained muscle contractions or postures involving one or more sites of the body." }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "DYT-TOR1A", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "DYT1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "EOTD", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Oppenheim dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Oppenheim's dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia musculorum deformans", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia-1, torsion", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early onset primary dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early onset torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset generalised torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset generalized limb-onset dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset generalized torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset primary dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "early-onset torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "idiopathic dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "torsion dystonia type 1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "DYT-TOR1A dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Dyt1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Early-onset Primary dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Early-onset torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "Primary torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia 1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia 1, torsion, Autosomal dominant", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia 1, torsion, autosomal dominant", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "dystonia musculorum deformans 1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "idiopathic dystonia DYT1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "idiopathic torsion dystonia", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "torsion dystonia 1", "description": "" }, { "id": "MONDO:0007492", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007492", "name": "torsion dystonia 1, autosomal dominant", "description": "" }, { "id": "MIM:128100", "resource": "MIM", "url": "https://www.omim.org/entry/128100", "name": "Dystonia 1, torsion, autosomal dominant", "description": "Dystonia 1, torsion, autosomal dominant" } ], "evidence": [ { "id": "543", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:543" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "common_name": "Rat" } ], "gene": [ { "name": "Atp5mc3", "url": "https://www.uniprot.org/uniprot/Q71S46", "locus": { "chromosome": "3", "start_pos": 58810535, "end_pos": 58814279, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000001596", "url": "https://www.ensembl.org/id/ENSRNOG00000001596" } ] } } ], "crossref": [ { "id": "ENSRNOG00000001596", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000001596", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd18182", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18182", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002379", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002379", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020537", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020537", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035921", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035921", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038662", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038662", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PAKMFAC", "url": "https://omabrowser.org/oma/group/PAKMFAC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "316029at2759", "url": "http://www.orthodb.org/?query=316029at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10031", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10031", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10031:SF32", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10031:SF32", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10031:SF46", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10031:SF46", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00137", "url": "http://pfam.xfam.org/family/PF00137", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q71S46", "url": "http://purl.obolibrary.org/obo/PR_Q71S46", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-163210", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-163210", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8949613", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8949613", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_446208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446208", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620052", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620052", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "F7EW45", "url": "https://www.uniprot.org/uniprot/F7EW45", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7EW45-1", "url": "https://www.uniprot.org/uniprot/F7EW45-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q499S2", "url": "https://www.uniprot.org/uniprot/Q499S2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q499S2-1", "url": "https://www.uniprot.org/uniprot/Q499S2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q71S46-1", "url": "https://www.uniprot.org/uniprot/Q71S46-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM", "length": 142, "header": "sp|Q71S46-1|AT5G3_RAT Isoform 1 of ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1 CANONICAL=Q71S46-1" }, "isoforms": [ { "isoform_ac": "F7EW45-1", "url": "", "sequence": { "sequence": "HFPCLSIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM", "length": 134, "header": "tr|F7EW45-1|F7EW45_RAT Computationally mapped isoform of ATP synthase lipid-binding protein OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=3 SV=1 CANONICAL=Q71S46-1" }, "locus": { "chromosome": "3", "start_pos": 58812529, "end_pos": 58810689, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000058234.4", "url": "https://www.ensembl.org/id/ENSRNOT00000058234.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000055032.2", "url": "https://www.ensembl.org/id/ENSRNOP00000055032.2" } ] } }, { "isoform_ac": "Q499S2-1", "url": "", "sequence": { "sequence": "MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM", "length": 141, "header": "tr|Q499S2-1|AT5G3_RAT Computationally mapped isoform of ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1 CANONICAL=Q71S46-1" }, "locus": { "chromosome": "3", "start_pos": 58812862, "end_pos": 58810689, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000117216.1", "url": "https://www.ensembl.org/id/ENSRNOT00000117216.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000088934.1", "url": "https://www.ensembl.org/id/ENSRNOP00000088934.1" } ] } }, { "isoform_ac": "Q71S46-1", "url": "", "sequence": { "sequence": "MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM", "length": 142, "header": "sp|Q71S46-1|AT5G3_RAT Isoform 1 of ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1 CANONICAL=Q71S46-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Rat mitochondrial ATP synthase ATP5G3: cloning and upregulation in pancreas after chronic ethanol feeding.", "journal": "Physiol. Genomics", "date": "2001", "authors": "Li HS, Zhang JY, Thompson BS, Deng XY, Ford ME, Wood PG, Stolz DB, Eagon PK, Whitcomb DC", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "reference": [ { "type": "PubMed", "id": "11459924", "url": "https://glygen.org/publication/PubMed/11459924" } ] }, { "title": "Lysine methylation by the mitochondrial methyltransferase FAM173B optimizes the function of mitochondrial ATP synthase.", "journal": "J. Biol. Chem.", "date": "2019", "authors": "Malecki JM, Willemen HLDM, Pinto R, Ho AYY, Moen A, Kjonstad IF, Burgering BMT, Zwartkruis F, Eijkelkamp N, Falnes PO", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "reference": [ { "type": "PubMed", "id": "30530489", "url": "https://glygen.org/publication/PubMed/30530489" } ] } ], "pathway": [ { "id": "R-RNO-163210", "name": "Formation of ATP by chemiosmotic coupling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-163210", "resource": "Reactome", "description": "Formation of ATP by chemiosmotic coupling" }, { "id": "R-RNO-8949613", "name": "Cristae formation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8949613", "resource": "Reactome", "description": "Cristae formation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "proton-transporting ATP synthase complex, coupling factor F(o)", "id": "GO:0045263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045263", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "cation channel complex", "id": "GO:0034703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034703", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)", "id": "GO:0000276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000276", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "proton transmembrane transporter activity", "id": "GO:0015078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015078", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "ligand-gated channel activity", "id": "GO:0022834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022834", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "proton motive force-driven ATP synthesis", "id": "GO:0015986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015986", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "response to muscle stretch", "id": "GO:0035994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035994", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "pore complex assembly", "id": "GO:0046931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046931", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" }, { "name": "response to (R)-carnitine", "id": "GO:0061959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061959", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Trimethylated by ATPSCKMT at Lys-110. Methylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration.", "evidence": [ { "database": "UniProtKB", "id": "Q71S46", "url": "https://www.uniprot.org/uniprot/Q71S46" }, { "database": "PubMed", "id": "30530489", "url": "https://glygen.org/publication/PubMed/30530489" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }