{ "uniprot_canonical_ac": "Q6ZQE4-1", "uniprot_ac": "Q6ZQE4", "uniprot_id": "NEMP1_MOUSE", "mass": { "chemical_mass": 49817.0, "monoisotopic_mass": 49817.0 }, "refseq": { "ac": "NP_776093", "name": "nuclear envelope integral membrane protein 1 isoform 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093" }, "gene_names": [ { "name": "Nemp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "id": "Q6ZQE4" }, { "name": "BC030440", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "id": "Q6ZQE4" }, { "name": "Kiaa0286", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "id": "Q6ZQE4" }, { "name": "Nemp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682", "id": "NP_001106682" }, { "name": "Tmem194; Tmem194a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682", "id": "NP_001106682" }, { "name": "Tmem194a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "id": "Q6ZQE4" }, { "name": "Tmem194", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "id": "Q6ZQE4" } ], "protein_names": [ { "name": "Nuclear envelope integral membrane protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6ZQE4" }, { "name": "nuclear envelope integral membrane protein 1 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682", "id": "NP_001106682" }, { "name": "nuclear envelope integral membrane protein 1 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093", "id": "NP_776093" }, { "name": "transmembrane protein 194A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093", "id": "NP_776093" } ], "function": [ { "annotation": "Nemp1 represents a new type of RanGTP-binding protein. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001106682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" }, { "database": "RefSeq", "id": "NP_776093", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093" } ] }, { "annotation": "The inner nuclear membrane protein NEMP1 supports nuclear envelope openings and enucleation of erythroblasts. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001106682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682" }, { "database": "PubMed", "id": "36215313", "url": "https://glygen.org/publication/PubMed/36215313" }, { "database": "RefSeq", "id": "NP_776093", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093" } ] }, { "annotation": "Together with EMD, contributes to nuclear envelope stiffness in germ cells (PubMed:32923640). Required for female fertility (PubMed:32923640).", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4#function" }, { "database": "PubMed", "id": "32923640", "url": "https://glygen.org/publication/PubMed/32923640" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389138640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389138640" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).", "chr_id": "10", "chr_pos": "127525214", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N123", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 366, "end_pos": 366, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-376; A/E-380; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 366, "end_pos": 366, "sequence_org": "S", "sequence_mut": "E", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-376; A/E-380; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 376, "end_pos": 376, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-380; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 376, "end_pos": 376, "sequence_org": "S", "sequence_mut": "E", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-380; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 380, "end_pos": 380, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-376; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 380, "end_pos": 380, "sequence_org": "S", "sequence_mut": "E", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-376; A/E-419 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 419, "end_pos": 419, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial loss of phosphorylation and loss of interaction with RAN; when associated with A/E-366; A/E-376; A/E-380 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 419, "end_pos": 419, "sequence_org": "S", "sequence_mut": "E", "comment": "Partial loss of phosphorylation and loss of interaction with RAN; when associated with A/E-366; A/E-376; A/E-380 and A/E-420.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 420, "end_pos": 420, "sequence_org": "S", "sequence_mut": "A", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-376; A/E-380 and A/E-419.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "start_pos": 420, "end_pos": 420, "sequence_org": "S", "sequence_mut": "E", "comment": "Partial loss of phosphorylation and loss of interaction with RAN-GTP; when associated with A/E-366; A/E-376; A/E-380 and A/E-419.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Nemp1", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "locus": { "chromosome": "10", "start_pos": 127536918, "end_pos": 127502770, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000040195", "url": "https://www.ensembl.org/id/ENSMUSG00000040195" } ] } } ], "crossref": [ { "id": "ENSMUSG00000040195", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000040195", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "210035", "url": "https://www.ncbi.nlm.nih.gov/gene/210035", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0002541", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002541", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0005910", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0005910", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0006775", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006775", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q6ZQE4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6ZQE4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:210035", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:210035", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2446113", "url": "http://www.informatics.jax.org/marker/MGI:2446113", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MAGCMKM", "url": "https://omabrowser.org/oma/group/MAGCMKM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3091795at2759", "url": "http://www.orthodb.org/?query=3091795at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13598", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13598", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13598:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13598:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10225", "url": "http://pfam.xfam.org/family/PF10225", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6ZQE4", "url": "http://purl.obolibrary.org/obo/PR_Q6ZQE4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001106682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9Q6Z3", "url": "https://www.uniprot.org/uniprot/E9Q6Z3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q6Z3-1", "url": "https://www.uniprot.org/uniprot/E9Q6Z3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6ZQE4-1", "url": "https://www.uniprot.org/uniprot/Q6ZQE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K2N3", "url": "https://www.uniprot.org/uniprot/Q8K2N3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8K2N3-1", "url": "https://www.uniprot.org/uniprot/Q8K2N3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGGIKVSVWSAVGPGPRCWGAGGGGGATWLLLVVAGCVVCGSADVNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQEYGLGSIFTQDEELSSEEEGSEYPTFTQNNFLT", "length": 437, "header": "sp|Q6ZQE4-1|NEMP1_MOUSE Isoform 1 of Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=2 CANONICAL=Q6ZQE4-1" }, "isoforms": [ { "isoform_ac": "E9Q6Z3-1", "url": "", "sequence": { "sequence": "MLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQEYGLGSIFTQDEELSSEEEGSEYPTFTQNNFLT", "length": 388, "header": "tr|E9Q6Z3-1|E9Q6Z3_MOUSE Computationally mapped isoform of Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=1 CANONICAL=Q6ZQE4-1" }, "locus": { "chromosome": "10", "start_pos": 127532259, "end_pos": 127524119, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118728.8", "url": "https://www.ensembl.org/id/ENSMUST00000118728.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113473.2", "url": "https://www.ensembl.org/id/ENSMUSP00000113473.2" } ] } }, { "isoform_ac": "Q6ZQE4-1", "url": "", "sequence": { "sequence": "MAGGIKVSVWSAVGPGPRCWGAGGGGGATWLLLVVAGCVVCGSADVNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQEYGLGSIFTQDEELSSEEEGSEYPTFTQNNFLT", "length": 437, "header": "sp|Q6ZQE4-1|NEMP1_MOUSE Isoform 1 of Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=2 CANONICAL=Q6ZQE4-1" }, "locus": { "chromosome": "10", "start_pos": 127532259, "end_pos": 127512967, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000048099", "url": "https://www.ensembl.org/id/ENSMUST00000048099" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000045988", "url": "https://www.ensembl.org/id/ENSMUSP00000045988" } ] } }, { "isoform_ac": "Q8K2N3-1", "url": "", "sequence": { "sequence": "MAGGIKVSVWSAVGPGPRCWGAGGGGGATWLLLVVAGCVVCGSADVNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYR", "length": 325, "header": "tr|Q8K2N3-1|NEMP1_MOUSE Computationally mapped isoform of Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=1 CANONICAL=Q6ZQE4-1" }, "locus": { "chromosome": "10", "start_pos": 127530524, "end_pos": 127512967, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118612.8", "url": "https://www.ensembl.org/id/ENSMUST00000118612.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113337.2", "url": "https://www.ensembl.org/id/ENSMUSP00000113337.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "Q6ZQE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQE4#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] } ], "phosphorylation": [ { "start_pos": 366, "end_pos": 366, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "site_lbl": "Ser366" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "site_lbl": "Ser419" }, { "start_pos": 420, "end_pos": 420, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "site_lbl": "Ser420" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4#ptm_processing" }, { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "The inner nuclear membrane protein Nemp1 is a new type of RanGTP-binding protein in eukaryotes.", "journal": "PLoS ONE", "date": "2015", "authors": "Shibano T, Mamada H, Hakuno F, Takahashi S, Taira M", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "RefSeq", "id": "NP_001106682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682" }, { "database": "RefSeq", "id": "NP_776093", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093" } ], "reference": [ { "type": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] }, { "title": "The NEMP family supports metazoan fertility and nuclear envelope stiffness.", "journal": "Sci. Adv.", "date": "2020", "authors": "Kim K., Sun Y., Wang X., Wu J., Wu S., Gingras A.C., Pelletier L., Qu Y., Jurisicova A., McNeill H., Meng J., Choi K., Goncalves J., Rosenfeld R., Dunham W.H., Schedl T., Ciruna B., Perry J.R.B., Godt D., Schirmer E.C., Pearson J.D., Hodzic D., Bremner R., Potter D., Brill J.A., Fabian L., Tsatskis Y., Robson M.I., Boswell C., Krchma K., Mohammad A.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "reference": [ { "type": "PubMed", "id": "32923640", "url": "https://glygen.org/publication/PubMed/32923640" } ] }, { "title": "The inner nuclear membrane protein NEMP1 supports nuclear envelope openings and enucleation of erythroblasts.", "journal": "PLoS biology", "date": "2022-10", "authors": "Hodzic Didier, Wu Jun, Krchma Karen, Jurisicova Andrea, Tsatskis Yonit, Liu Yijie, Ji Peng, Choi Kyunghee, McNeill Helen", "evidence": [ { "database": "RefSeq", "id": "NP_776093", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_776093" }, { "database": "RefSeq", "id": "NP_001106682", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001106682" } ], "reference": [ { "type": "PubMed", "id": "36215313", "url": "https://glygen.org/publication/PubMed/36215313" } ] } ], "pathway": [ { "id": "mmu:210035", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:210035", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "M0R7R7-1", "protein_name": "Nuclear envelope integral membrane protein 1", "gene_name": "Nemp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGGIKVAVWSAVGPGPGCCGAGGGGAAWLLLVVAGCVVGCSAGIDVNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDSEERLKELEQFSVWNSLSSFLKEKLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVTRRFDPKLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKLMPKRSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWTLQLLGLGFMYSGIQIPHVAFALIVIALCTKNLEYPIYWLYSTYRRMCKASEKPVPPRLLTEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEVSVHEQEYGLGSILAQDEELSSEEEGSEDLPLTQNSFLT", "length": 438 }, "evidence": [ { "id": "45234825", "url": "http://www.informatics.jax.org/homology/45234825", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O14524-1", "protein_name": "Nuclear envelope integral membrane protein 1", "gene_name": "NEMP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGGMKVAVSPAVGPGPWGSGVGGGGTVRLLLILSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRIQIRVNSSRLVRVTQVENEEKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYVLTVGFMSFAVCYKYGPLENERSINLLTWTLQLMGLCFMYSGIQIPHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNFLT", "length": 444 }, "evidence": [ { "id": "45234825", "url": "http://www.informatics.jax.org/homology/45234825", "database": "MGI" }, { "id": "Q6ZQE4", "url": "https://omabrowser.org/oma/group/Q6ZQE4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "pmid": "" }, { "name": "nuclear inner membrane", "id": "GO:0005637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005637", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nuclear membrane organization", "id": "GO:0071763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071763", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" }, { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" }, { "start_pos": 86, "end_pos": 88, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylation may regulate its interaction with RAN-GTP.", "evidence": [ { "database": "UniProtKB", "id": "Q6ZQE4", "url": "https://www.uniprot.org/uniprot/Q6ZQE4" }, { "database": "PubMed", "id": "25946333", "url": "https://glygen.org/publication/PubMed/25946333" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }