{ "uniprot_canonical_ac": "Q6WNK7-1", "uniprot_ac": "Q6WNK7", "uniprot_id": "SUS1_YEAST", "mass": { "chemical_mass": 11085.0, "monoisotopic_mass": 11085.0 }, "refseq": { "ac": "NP_878049", "name": "Sus1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878049" }, "gene_names": [ { "name": "SUS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6WNK7", "id": "Q6WNK7" }, { "name": "SUS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878049", "id": "NP_878049" } ], "protein_names": [ { "name": "Transcription and mRNA export factor SUS1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6WNK7" }, { "name": "Sus1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878049", "id": "NP_878049" } ], "function": [ { "annotation": "Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is involved in RNA polymerase II-dependent regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). Within the SAGA complex, participates in a subcomplex with SGF11, SGF73 and UBP8 required for deubiquitination of H2B and for the maintenance of steady-state H3 methylation levels. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket), by association with components of the nuclear mRNA export machinery (MEX67-MTR2 and SUB2) in the nucleoplasm and the nucleoporin NUP1 at the nuclear basket. TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. SUS1 has also a role in mRNP biogenesis and maintenance of genome integrity through preventing RNA-mediated genome instability. Has a role in response to DNA damage induced by methyl methane sulfonate (MMS) and replication arrest induced by hydroxyurea. May also be involved in cytoplasmic mRNA decay by interaction with components of P-bodies.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7#function" }, { "database": "PubMed", "id": "15311284", "url": "https://glygen.org/publication/PubMed/15311284" }, { "database": "PubMed", "id": "18923079", "url": "https://glygen.org/publication/PubMed/18923079" }, { "database": "PubMed", "id": "16855026", "url": "https://glygen.org/publication/PubMed/16855026" }, { "database": "PubMed", "id": "20230609", "url": "https://glygen.org/publication/PubMed/20230609" }, { "database": "PubMed", "id": "18667528", "url": "https://glygen.org/publication/PubMed/18667528" }, { "database": "PubMed", "id": "16510898", "url": "https://glygen.org/publication/PubMed/16510898" }, { "database": "PubMed", "id": "21749978", "url": "https://glygen.org/publication/PubMed/21749978" }, { "database": "PubMed", "id": "18003937", "url": "https://glygen.org/publication/PubMed/18003937" }, { "database": "PubMed", "id": "21749979", "url": "https://glygen.org/publication/PubMed/21749979" }, { "database": "PubMed", "id": "16760982", "url": "https://glygen.org/publication/PubMed/16760982" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SUS1", "url": "https://www.uniprot.org/uniprot/Q6WNK7", "locus": {} } ], "crossref": [ { "id": "1466445", "url": "https://www.ncbi.nlm.nih.gov/gene/1466445", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6WNK7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6WNK7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038212", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038212", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YBR111W-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR111W-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YESGWFD", "url": "https://omabrowser.org/oma/group/YESGWFD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2719216at2759", "url": "http://www.orthodb.org/?query=2719216at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12514", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12514", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12514:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12514:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3FWB", "url": "https://www.rcsb.org/structure/3FWB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FWC", "url": "https://www.rcsb.org/structure/3FWC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KIK", "url": "https://www.rcsb.org/structure/3KIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KJL", "url": "https://www.rcsb.org/structure/3KJL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3M99", "url": "https://www.rcsb.org/structure/3M99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MHH", "url": "https://www.rcsb.org/structure/3MHH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MHS", "url": "https://www.rcsb.org/structure/3MHS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4C31", "url": "https://www.rcsb.org/structure/4C31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FIP", "url": "https://www.rcsb.org/structure/4FIP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FJC", "url": "https://www.rcsb.org/structure/4FJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FK5", "url": "https://www.rcsb.org/structure/4FK5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MBE", "url": "https://www.rcsb.org/structure/4MBE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WA6", "url": "https://www.rcsb.org/structure/4WA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZUX", "url": "https://www.rcsb.org/structure/4ZUX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AQR", "url": "https://www.rcsb.org/structure/6AQR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T9L", "url": "https://www.rcsb.org/structure/6T9L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF10163", "url": "http://pfam.xfam.org/family/PF10163", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6WNK7", "url": "http://purl.obolibrary.org/obo/PR_Q6WNK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_878049", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878049", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028510", "url": "https://www.yeastgenome.org/locus/S000028510", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6WNK7-1", "url": "https://www.uniprot.org/uniprot/Q6WNK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ", "length": 96, "header": "sp|Q6WNK7-1|SUS1_YEAST Isoform 1 of Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SUS1 PE=1 SV=1 CANONICAL=Q6WNK7-1" }, "isoforms": [ { "isoform_ac": "Q6WNK7-1", "url": "", "sequence": { "sequence": "MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ", "length": 96, "header": "sp|Q6WNK7-1|SUS1_YEAST Isoform 1 of Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SUS1 PE=1 SV=1 CANONICAL=Q6WNK7-1" }, "locus": { "chromosome": "II", "start_pos": 462576, "end_pos": 462139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YBR111W-A_mRNA", "url": "https://www.ensembl.org/id/YBR111W-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YBR111W-A", "url": "https://www.ensembl.org/id/YBR111W-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sus1, a functional component of the SAGA histone acetylase complex and the nuclear pore-associated mRNA export machinery.", "journal": "Cell", "date": "2004", "authors": "Rodr\u00edguez-Navarro Susana, Fischer Tam\u00e1s, Luo Ming-Juan, Ant\u00fanez Oreto, Brettschneider Susanne, Lechner Johannes, P\u00e9rez-Ort\u00edn Jose E, Reed Robin, Hurt Ed", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "14718168", "url": "https://glygen.org/publication/PubMed/14718168" } ] }, { "title": "Molecular architecture of the S. cerevisiae SAGA complex.", "journal": "Mol. Cell", "date": "2004", "authors": "Winston F., Schultz P., Wu P.Y., Ruhlmann C.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "15260971", "url": "https://glygen.org/publication/PubMed/15260971" } ] }, { "title": "Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery.", "journal": "Nat. Cell Biol.", "date": "2004", "authors": "Fischer T., Pereira G., Schiebel E., Racz A., Hurt E.C., Rodriguez-Navarro S.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "15311284", "url": "https://glygen.org/publication/PubMed/15311284" } ] }, { "title": "Functional genomics of genes with small open reading frames (sORFs) in S. cerevisiae.", "journal": "Genome Res.", "date": "2006", "authors": "Boeke J.D., Yang H., Ni L., Davis R.W., Basrai M.A., Chu A., Au W.-C., Snyder M.A., Carter C.D., Kastenmayer J.P., Kitchen L.E., Wheeler D.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "16510898", "url": "https://glygen.org/publication/PubMed/16510898" } ] }, { "title": "SAGA interacting factors confine sub-diffusion of transcribed genes to the nuclear envelope.", "journal": "Nature", "date": "2006", "authors": "Hurt E.C., Olivo-Marin J.-C., Gadal O., Rodriguez-Navarro S., Buc H., Nehrbass U., Cabal G.G., Feuerbach-Fournier F., Genovesio A., Lesne A., Zimmer C.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "16760982", "url": "https://glygen.org/publication/PubMed/16760982" } ] }, { "title": "The mRNA export factor Sus1 is involved in Spt/Ada/Gcn5 acetyltransferase-mediated H2B deubiquitinylation through its interaction with Ubp8 and Sgf11.", "journal": "Mol. Biol. Cell", "date": "2006", "authors": "Koehler A., Hurt E.C., Posas F., Rodriguez-Navarro S., Pascual-Garcia P., Zapater M., Llopis A.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "16855026", "url": "https://glygen.org/publication/PubMed/16855026" } ] }, { "title": "Sus1, Sac3, and Thp1 mediate post-transcriptional tethering of active genes to the nuclear rim as well as to non-nascent mRNP.", "journal": "RNA", "date": "2008", "authors": "Rosbash M., Abruzzi K.C., Belostotsky D.A., Chekanova J.A.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "18003937", "url": "https://glygen.org/publication/PubMed/18003937" } ] }, { "title": "Yeast Ataxin-7 links histone deubiquitination with gene gating and mRNA export.", "journal": "Nat. Cell Biol.", "date": "2008", "authors": "Schneider M., Hurt E., Koehler A., Nehrbass U., Cabal G.G.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "18488019", "url": "https://glygen.org/publication/PubMed/18488019" } ] }, { "title": "The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Aguilera A., Huertas P., Gomez-Gonzalez B., Luna R., Gonzalez-Aguilera C., Tous C.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "18667528", "url": "https://glygen.org/publication/PubMed/18667528" } ] }, { "title": "Sus1 is recruited to coding regions and functions during transcription elongation in association with SAGA and TREX2.", "journal": "Genes Dev.", "date": "2008", "authors": "Hinnebusch A.G., Rodriguez-Navarro S., Pascual-Garcia P., Chavez S., Cuenca-Bono B., Govind C.K., Llopis A., Queralt E.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "18923079", "url": "https://glygen.org/publication/PubMed/18923079" } ] }, { "title": "Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.", "journal": "Mol. Cell", "date": "2009", "authors": "Fischer T., Lutz S., Hurt E., Jani D., Stewart M., Ellisdon A.M., Kohler A., Marshall N.J.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "19328066", "url": "https://glygen.org/publication/PubMed/19328066" } ] }, { "title": "Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Ellisdon Andrew M, Jani Divyang, K\u00f6hler Alwin, Hurt Ed, Stewart Murray", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "20007317", "url": "https://glygen.org/publication/PubMed/20007317" } ] }, { "title": "A novel link between Sus1 and the cytoplasmic mRNA decay machinery suggests a broad role in mRNA metabolism.", "journal": "BMC Cell Biol.", "date": "2010", "authors": "Rodriguez-Navarro S., Pascual-Garcia P., Cuenca-Bono B., Garcia-Molinero V., Garcia-Oliver E., Llopis A.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "20230609", "url": "https://glygen.org/publication/PubMed/20230609" } ] }, { "title": "Structural insights into the assembly and function of the SAGA deubiquitinating module.", "journal": "Science", "date": "2010", "authors": "Cohen R.E., Yao T., Zhang X., Wolberger C., Berndsen C.E., Samara N.L., Datta A.B.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "20395473", "url": "https://glygen.org/publication/PubMed/20395473" } ] }, { "title": "Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.", "journal": "Cell", "date": "2010", "authors": "K\u00f6hler Alwin, Zimmerman Erik, Schneider Maren, Hurt Ed, Zheng Ning", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "20434206", "url": "https://glygen.org/publication/PubMed/20434206" } ] }, { "title": "Key features of the two-intron Saccharomyces cerevisiae gene SUS1 contribute to its alternative splicing.", "journal": "Nucleic Acids Res.", "date": "2011", "authors": "Johnson T.L., Hossain M.A., Rodriguez C.M.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "21749978", "url": "https://glygen.org/publication/PubMed/21749978" } ] }, { "title": "SUS1 introns are required for efficient mRNA nuclear export in yeast.", "journal": "Nucleic Acids Res.", "date": "2011", "authors": "Rodriguez-Navarro S., Pascual-Garcia P., Cuenca-Bono B., Dopazo H., Garcia-Molinero V., Llopis A., Vilardell J.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "21749979", "url": "https://glygen.org/publication/PubMed/21749979" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "A role for intersubunit interactions in maintaining SAGA deubiquitinating module structure and activity.", "journal": "Structure", "date": "2012", "authors": "Wolberger C., Ringel A.E., Samara N.L.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "22771212", "url": "https://glygen.org/publication/PubMed/22771212" } ] }, { "title": "A novel role for Sem1 and TREX-2 in transcription involves their impact on recruitment and H2B deubiquitylation activity of SAGA.", "journal": "Nucleic Acids Res.", "date": "2013", "authors": "Rodriguez-Navarro S., Holstege F.C., Pascual-Garcia P., Garcia-Molinero V., Garcia-Oliver E., Lenstra T.L.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "23599000", "url": "https://glygen.org/publication/PubMed/23599000" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] } ], "pathway": [ { "id": "sce:YBR111W-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBR111W-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "poly(A)+ mRNA export from nucleus", "id": "GO:0016973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016973", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "nuclear mRNA surveillance", "id": "GO:0071028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071028", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "mRNA export from nucleus", "id": "GO:0006406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006406", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "transcription elongation by RNA polymerase II", "id": "GO:0006368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006368", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "histone acetylation", "id": "GO:0016573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016573", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "histone deubiquitination", "id": "GO:0016578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016578", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery", "id": "GO:0000973", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000973", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "nuclear pore", "id": "GO:0005643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005643", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "DUBm complex", "id": "GO:0071819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071819", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "transcription export complex 2", "id": "GO:0070390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070390", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "SAGA complex", "id": "GO:0000124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000124", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" }, { "name": "SLIK (SAGA-like) complex", "id": "GO:0046695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046695", "evidence": [ { "database": "UniProtKB", "id": "Q6WNK7", "url": "https://www.uniprot.org/uniprot/Q6WNK7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 53, "end_pos": 55, "annotation": "n_glycosylation_sequon" }, { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }