{ "uniprot_canonical_ac": "Q6Q595-1", "uniprot_ac": "Q6Q595", "uniprot_id": "SCS22_YEAST", "mass": { "chemical_mass": 19678.0, "monoisotopic_mass": 19678.0 }, "refseq": { "ac": "NP_009461", "name": "phospholipid metabolism-regulating protein SCS22", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009461" }, "gene_names": [ { "name": "SCS22", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6Q595", "id": "Q6Q595" }, { "name": "SCS22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009461", "id": "NP_009461" } ], "protein_names": [ { "name": "Vesicle-associated membrane protein-associated protein SCS22", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6Q595" }, { "name": "VAMP-associated protein SCS22", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6Q595" }, { "name": "VAP homolog 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6Q595" }, { "name": "phospholipid metabolism-regulating protein SCS22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009461", "id": "NP_009461" } ], "function": [ { "annotation": "Targets proteins containing a FFAT motif to membranes (By similarity). Involved in regulation of phospholipid metabolism.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595#function" }, { "database": "PubMed", "id": "15668246", "url": "https://glygen.org/publication/PubMed/15668246" } ] } ], "disease": [ { "disease_id": "DOID:0050752", "recommended_name": { "id": "DOID:0050752", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050752", "name": "amyotrophic lateral sclerosis type 8", "description": "An amyotrophic lateral sclerosis that has_material_basis_in mutation in the VAPB gene on chromosome 20." }, "synonyms": [ { "id": "DOID:0050752", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050752", "name": "ALS8", "description": "" }, { "id": "DOID:0050752", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050752", "name": "amyotrophic lateral sclerosis 8", "description": "" }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "amyotrophic lateral sclerosis type 8", "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the VAPB gene." }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "ALS8", "description": "" }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "VAPB amyotrophic lateral sclerosis", "description": "" }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "amyotrophic lateral sclerosis 8", "description": "" }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "amyotrophic lateral sclerosis caused by mutation in VAPB", "description": "" }, { "id": "MONDO:0012077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012077", "name": "amyotrophic lateral sclerosis type 8", "description": "" }, { "id": "MIM:608627", "resource": "MIM", "url": "https://www.omim.org/entry/608627", "name": "Amyotrophic lateral sclerosis 8", "description": "Amyotrophic lateral sclerosis 8" } ], "evidence": [ { "id": "0050752", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050752" } ] }, { "disease_id": "DOID:0111194", "recommended_name": { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "autosomal dominant adult-onset proximal spinal muscular atrophy", "description": "A spinal muscular atrophy characterized by adult-onset of slowly progressive, proximal muscular weakness with fasciculations and absent/hypoactive deep tendon reflexes, without bulbar or pyramidal involvement that has_material_basis_in heterozygous mutation in VAPB on 20q13." }, "synonyms": [ { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "Finkel disease", "description": "" }, { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "Finkel late-adult type SMA", "description": "" }, { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "SMAFK", "description": "" }, { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "autosomal dominant adult-onset proximal SMA", "description": "" }, { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "autosomal dominant late-onset spinal muscular atrophy, Finkel type", "description": "" }, { "id": "DOID:0111194", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111194", "name": "autosomal dominant adult proximal spinal muscular atrophy", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "adult-onset proximal spinal muscular atrophy, autosomal dominant", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "Finkel disease", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "autosomal dominant adult-onset proximal SMA", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "autosomal dominant late-onset spinal muscular atrophy, Finkel type", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "Finkel late-adult type Sma", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "SMAFK", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "autosomal dominant adult-onset proximal spinal muscular atrophy", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "spinal muscular atrophy, late-onset, FINKEL type", "description": "" }, { "id": "MONDO:0008453", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008453", "name": "spinal muscular atrophy, proximal, adult, autosomal dominant", "description": "" }, { "id": "MIM:182980", "resource": "MIM", "url": "https://www.omim.org/entry/182980", "name": "Spinal muscular atrophy, proximal, adult, autosomal dominant", "description": "Spinal muscular atrophy, proximal, adult, autosomal dominant" } ], "evidence": [ { "id": "0111194", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111194" } ] }, { "disease_id": "DOID:12377", "recommended_name": { "id": "DOID:12377", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12377", "name": "spinal muscular atrophy", "description": "A motor neuron disease that is a degenerative neuromuscular disease characterized by lower motor neuron degeneration associated with progressive muscle weakness and atrophy." }, "synonyms": [], "evidence": [ { "id": "12377", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12377" } ] }, { "disease_id": "DOID:1289", "recommended_name": { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "neurodegenerative disease", "description": "A central nervous system disease that results in the progressive deterioration of function or structure of neurons." }, "synonyms": [ { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "degenerative disease", "description": "" } ], "evidence": [ { "id": "1289", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1289" } ] }, { "disease_id": "DOID:231", "recommended_name": { "id": "DOID:231", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:231", "name": "motor neuron disease", "description": "A neurodegenerative disease that is located_in the motor neurons." }, "synonyms": [], "evidence": [ { "id": "231", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:231" } ] }, { "disease_id": "DOID:332", "recommended_name": { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "amyotrophic lateral sclerosis", "description": "A motor neuron disease that is characterized by muscle spasticity, rapidly progressive weakness due to muscle atrophy, difficulty in speaking, swallowing, and breathing." }, "synonyms": [ { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "ALS", "description": "" }, { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "Lou Gehrig's disease", "description": "" }, { "id": "DOID:332", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:332", "name": "motor neuron disease, bulbar", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis type 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "ALS1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis type 1", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "FALS", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal dominant", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal dominant amyotrophic lateral sclerosis 1, autosomal recessive, included", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, autosomal recessive", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis 1, familial", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, autosomal dominant", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, familial", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, sporadic", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, sporadic, included", "description": "" }, { "id": "MONDO:0007103", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007103", "name": "amyotrophic lateral sclerosis, susceptibility to", "description": "" }, { "id": "MIM:105400", "resource": "MIM", "url": "https://www.omim.org/entry/105400", "name": "Amyotrophic lateral sclerosis 1", "description": "Amyotrophic lateral sclerosis 1" } ], "evidence": [ { "id": "332", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:332" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "common_name": "Yeast" } ], "gene": [ { "name": "SCS22", "url": "https://www.uniprot.org/uniprot/Q6Q595", "locus": {} } ], "crossref": [ { "id": "852186", "url": "https://www.ncbi.nlm.nih.gov/gene/852186", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6Q595", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6Q595*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000535", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000535", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008962", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008962", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016763", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016763", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YBL091C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL091C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TAPKIYC", "url": "https://omabrowser.org/oma/group/TAPKIYC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "122649at2759", "url": "http://www.orthodb.org/?query=122649at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10809", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10809", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10809:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10809:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00635", "url": "http://pfam.xfam.org/family/PF00635", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6Q595", "url": "http://purl.obolibrary.org/obo/PR_Q6Q595", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_009461", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009461", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000007228", "url": "https://www.yeastgenome.org/locus/S000007228", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6Q595-1", "url": "https://www.uniprot.org/uniprot/Q6Q595-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVFKKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY", "length": 175, "header": "sp|Q6Q595-1|SCS22_YEAST Isoform 1 of Vesicle-associated membrane protein-associated protein SCS22 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SCS22 PE=1 SV=2 CANONICAL=Q6Q595-1" }, "isoforms": [ { "isoform_ac": "Q6Q595-1", "url": "", "sequence": { "sequence": "MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVFKKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY", "length": 175, "header": "sp|Q6Q595-1|SCS22_YEAST Isoform 1 of Vesicle-associated membrane protein-associated protein SCS22 OS=Saccharomyces cerevisiae S288C OX=559292 GN=SCS22 PE=1 SV=2 CANONICAL=Q6Q595-1" }, "locus": { "chromosome": "II", "start_pos": 47180, "end_pos": 46568, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YBL091C-A_mRNA", "url": "https://www.ensembl.org/id/YBL091C-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YBL091C-A", "url": "https://www.ensembl.org/id/YBL091C-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii.", "journal": "Genome Biol.", "date": "2003", "authors": "Zhang Z., Philippsen P., Stuart L., Dietrich F.S., Brachat S., Gaffney T.D., Gates K., Lerch A., Voegeli S.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "12844361", "url": "https://glygen.org/publication/PubMed/12844361" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A highly conserved binding site in vesicle-associated membrane protein-associated protein (VAP) for the FFAT motif of lipid-binding proteins.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Loewen CJ, Levine TP", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "15668246", "url": "https://glygen.org/publication/PubMed/15668246" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II.", "journal": "Yeast", "date": "1995", "authors": "Gassenhuber J., Obermaier B., Domdey H., Piravandi E.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "7502586", "url": "https://glygen.org/publication/PubMed/7502586" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] } ], "pathway": [ { "id": "sce:YBL091C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL091C-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "endoplasmic reticulum membrane organization", "id": "GO:0090158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090158", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" }, { "name": "regulation of phosphatidylinositol dephosphorylation", "id": "GO:0060304", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060304", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" }, { "name": "phospholipid biosynthetic process", "id": "GO:0008654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008654", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" }, { "name": "endoplasmic reticulum-plasma membrane tethering", "id": "GO:0061817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061817", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "FFAT motif binding", "id": "GO:0033149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033149", "evidence": [ { "database": "UniProtKB", "id": "Q6Q595", "url": "https://www.uniprot.org/uniprot/Q6Q595" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }