{ "uniprot_canonical_ac": "Q6PKG0-1", "uniprot_ac": "Q6PKG0", "uniprot_id": "LARP1_HUMAN", "mass": { "chemical_mass": 123510.0, "monoisotopic_mass": 123510.0 }, "refseq": { "ac": "NP_056130", "name": "la-related protein 1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, "gene_names": [ { "name": "LARP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "id": "Q6PKG0" }, { "name": "KIAA0731", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "id": "Q6PKG0" }, { "name": "LARP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "id": "Q6PKG0" }, { "name": "hCG_36852", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "id": "Q6PKG0" } ], "protein_names": [ { "name": "La-related protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6PKG0" }, { "name": "La ribonucleoprotein domain family member 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6PKG0" }, { "name": "la-related protein 1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130", "id": "NP_056130" }, { "name": "la-related protein 1; La ribonucleoprotein domain family member 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130", "id": "NP_056130" } ], "function": [ { "annotation": "(Microbial infection) Positively regulates the replication of dengue virus (DENV).", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0#function" }, { "database": "PubMed", "id": "26735137", "url": "https://glygen.org/publication/PubMed/26735137" } ] }, { "annotation": "Global analysis of RNA-binding proteins identifies a positive feedback loop between LARP1 and MYC that promotes tumorigenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "35195778", "url": "https://glygen.org/publication/PubMed/35195778" } ] }, { "annotation": "Long non-coding RNA LINC01270 is an onco-promotor in lung adenocarcinoma by upregulating LARP1 via sponging miR-326.", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "36694453", "url": "https://glygen.org/publication/PubMed/36694453" } ] }, { "annotation": "Nuclear trafficking of La protein depends on a newly identified nucleolar localization signal and the ability to bind RNA", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "15060081", "url": "https://glygen.org/publication/PubMed/15060081" } ] }, { "annotation": "O-GlcNAcylated LARP1 positively regulated by circCLNS1A facilitates hepatoblastoma progression through DKK4/beta-catenin signalling.", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "37070251", "url": "https://glygen.org/publication/PubMed/37070251" } ] }, { "annotation": "RNA-binding protein that regulates the translation of specific target mRNA species downstream of the mTORC1 complex, in function of growth signals and nutrient availability (PubMed:20430826, PubMed:23711370, PubMed:24532714, PubMed:25940091, PubMed:28650797, PubMed:28673543, PubMed:29244122). Interacts on the one hand with the 3' poly-A tails that are present in all mRNA molecules, and on the other hand with the 7-methylguanosine cap structure of mRNAs containing a 5' terminal oligopyrimidine (5'TOP) motif, which is present in mRNAs encoding ribosomal proteins and several components of the translation machinery (PubMed:23711370, PubMed:25940091, PubMed:28650797, PubMed:29244122, PubMed:26206669, PubMed:28379136). The interaction with the 5' end of mRNAs containing a 5'TOP motif leads to translational repression by preventing the binding of EIF4G1 (PubMed:25940091, PubMed:28650797, PubMed:29244122, PubMed:28379136). When mTORC1 is activated, LARP1 is phosphorylated and dissociates from the 5' untranslated region (UTR) of mRNA (PubMed:25940091, PubMed:28650797). Does not prevent binding of EIF4G1 to mRNAs that lack a 5'TOP motif (PubMed:28379136). Interacts with the free 40S ribosome subunit and with ribosomes, both monosomes and polysomes (PubMed:20430826, PubMed:24532714, PubMed:25940091, PubMed:28673543). Under normal nutrient availability, interacts primarily with the 3' untranslated region (UTR) of mRNAs encoding ribosomal proteins and increases protein synthesis (PubMed:23711370, PubMed:28650797). Associates with actively translating ribosomes and stimulates translation of mRNAs containing a 5'TOP motif, thereby regulating protein synthesis, and as a consequence, cell growth and proliferation (PubMed:20430826, PubMed:24532714). Stabilizes mRNAs species with a 5'TOP motif, which is required to prevent apoptosis (PubMed:20430826, PubMed:23711370, PubMed:25940091, PubMed:28673543).", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0#function" }, { "database": "PubMed", "id": "24532714", "url": "https://glygen.org/publication/PubMed/24532714" }, { "database": "PubMed", "id": "26206669", "url": "https://glygen.org/publication/PubMed/26206669" }, { "database": "PubMed", "id": "20430826", "url": "https://glygen.org/publication/PubMed/20430826" }, { "database": "PubMed", "id": "23711370", "url": "https://glygen.org/publication/PubMed/23711370" }, { "database": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" }, { "database": "PubMed", "id": "28379136", "url": "https://glygen.org/publication/PubMed/28379136" }, { "database": "PubMed", "id": "29244122", "url": "https://glygen.org/publication/PubMed/29244122" }, { "database": "PubMed", "id": "28673543", "url": "https://glygen.org/publication/PubMed/28673543" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "annotation": "The RNA-binding protein LARP1 is dispensable for pancreatic beta-cell function and mass. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "33483593", "url": "https://glygen.org/publication/PubMed/33483593" } ] }, { "annotation": "The SARS-CoV-2 RNA interactome.", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" }, { "database": "PubMed", "id": "33989516", "url": "https://glygen.org/publication/PubMed/33989516" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "Q6PKG0", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q6PKG0" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 148, "end_pos": 148, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "154790331", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S148", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs765759157", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765759157" }, { "id": "rs765759157", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765759157" }, { "id": "rs765759157", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765759157#frequency_tab" }, { "id": "rs765759157", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765759157" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 215, "end_pos": 215, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SDS->NDS).", "chr_id": "5", "chr_pos": "154792701", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S215", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765076218", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765076218" }, { "id": "rs765076218", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765076218" }, { "id": "rs765076218", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765076218#frequency_tab" }, { "id": "rs765076218", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765076218" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 660, "end_pos": 660, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DRT->NRT).", "chr_id": "5", "chr_pos": "154802268", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D660", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1200830303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1200830303" }, { "id": "rs1200830303", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1200830303#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 672, "end_pos": 672, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "154802305", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S672", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373756763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373756763" }, { "id": "rs373756763", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373756763" }, { "id": "rs373756763", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373756763#frequency_tab" }, { "id": "rs373756763", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373756763" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 769, "end_pos": 769, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "154803611", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T769", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768162789", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768162789" }, { "id": "rs768162789", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768162789" }, { "id": "rs768162789", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768162789" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 770, "end_pos": 770, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "154803614", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T770", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "Q6PKG0", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q6PKG0" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 778, "end_pos": 778, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NYR->NYS).", "chr_id": "5", "chr_pos": "154803638", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R778", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs750450784", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750450784" }, { "id": "rs750450784", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750450784" }, { "id": "rs750450784", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750450784" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 795, "end_pos": 795, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SQT->NQT).", "chr_id": "5", "chr_pos": "154803690", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S795", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1058, "end_pos": 1058, "sequence_org": "S", "sequence_mut": "A", "comment": "Strongly reduced phosphorylation mediated by AKT and RPS6KB1. Decreased interaction with RPTOR and impaired dissociation from the 5'UTR of mRNA molecules; when associated with A-766; A-769 and A-847.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "start_pos": 497, "end_pos": 507, "sequence_org": "SQLLNCPEFVP", "sequence_mut": "", "comment": "Strongly reduced interaction with PABPC1.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "start_pos": 505, "end_pos": 505, "sequence_org": "F", "sequence_mut": "A", "comment": "Strongly reduced interaction with PABPC1.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "start_pos": 766, "end_pos": 766, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation by MTOR; when associated with A-769. Decreased interaction with RPTOR and impaired dissociation from the 5'UTR of mRNA molecules; when associated with A-769; A-847 and A-1058.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "start_pos": 769, "end_pos": 769, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation by MTOR; when associated with A-766. Decreased interaction with RPTOR and impaired dissociation from the 5'UTR of mRNA molecules; when associated with A-766; A-847 and A-1058.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "start_pos": 847, "end_pos": 847, "sequence_org": "S", "sequence_mut": "A", "comment": "Strongly reduced phosphorylation mediated by Akt and RPS6KB1. Decreased interaction with RPTOR and impaired dissociation from the 5'UTR of mRNA molecules; when associated with A-766; A-769 and A-1058.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "start_pos": 917, "end_pos": 917, "sequence_org": "R", "sequence_mut": "E", "comment": "Abolishes RNA binding. Abolishes inhibition of EIF4G1 binding to mRNA molecules with a 5'TOP motif; when associated with A-960.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "26206669", "url": "https://glygen.org/publication/PubMed/26206669" }, { "database": "PubMed", "id": "28379136", "url": "https://glygen.org/publication/PubMed/28379136" } ] }, { "start_pos": 960, "end_pos": 960, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes RNA binding. Abolishes translational repression of mRNAs with a 5'TOP motif. Abolishes inhibition of EIF4G1 binding to mRNA molecules with a 5'TOP motif; when associated with E-917.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "26206669", "url": "https://glygen.org/publication/PubMed/26206669" }, { "database": "PubMed", "id": "28379136", "url": "https://glygen.org/publication/PubMed/28379136" }, { "database": "PubMed", "id": "29244122", "url": "https://glygen.org/publication/PubMed/29244122" } ] }, { "start_pos": 963, "end_pos": 963, "sequence_org": "E", "sequence_mut": "R", "comment": "Strongly decreased RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28379136", "url": "https://glygen.org/publication/PubMed/28379136" } ] }, { "start_pos": 966, "end_pos": 966, "sequence_org": "F", "sequence_mut": "A", "comment": "No effect on interaction with RPTOR.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "start_pos": 966, "end_pos": 970, "sequence_org": "FRLDI", "sequence_mut": "", "comment": "Loss of interaction with RPTOR.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "start_pos": 999, "end_pos": 999, "sequence_org": "Y", "sequence_mut": "A", "comment": "Strongly decreased RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28379136", "url": "https://glygen.org/publication/PubMed/28379136" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "93.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6PKG0" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "common_name": "Human" } ], "gene": [ { "name": "LARP1", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "locus": { "chromosome": "5", "start_pos": 154817605, "end_pos": 154682986, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000155506", "url": "https://www.ensembl.org/id/ENSG00000155506" } ] } } ], "crossref": [ { "id": "ENSG00000155506", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155506", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "Q6PKG0", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q6PKG0", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd08037", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08037", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "LARP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LARP1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "23367", "url": "https://www.ncbi.nlm.nih.gov/gene/23367", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "29531", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29531", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A0A0B4J210", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A0B4J210*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q6PKG0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6PKG0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006607", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006607", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006630", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006630", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045180", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045180", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:23367", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23367", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "612059", "url": "http://www.omim.org/entry/612059", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q6PKG0", "url": "https://www.nextprot.org/entry/NX_Q6PKG0", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EDCQRSG", "url": "https://omabrowser.org/oma/group/EDCQRSG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "24041at2759", "url": "http://www.orthodb.org/?query=24041at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22792", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22792", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22792:SF51", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22792:SF51", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4ZC4", "url": "https://www.rcsb.org/structure/4ZC4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C0V", "url": "https://www.rcsb.org/structure/5C0V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V4R", "url": "https://www.rcsb.org/structure/5V4R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V7C", "url": "https://www.rcsb.org/structure/5V7C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V87", "url": "https://www.rcsb.org/structure/5V87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PW3", "url": "https://www.rcsb.org/structure/6PW3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05383", "url": "http://pfam.xfam.org/family/PF05383", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q6PKG0", "url": "https://pharos.nih.gov/targets/Q6PKG0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q6PKG0", "url": "http://purl.obolibrary.org/obo/PR_Q6PKG0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4J210-1", "url": "https://www.uniprot.org/uniprot/A0A0B4J210-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KSP1", "url": "https://www.uniprot.org/uniprot/A0A8I5KSP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KSP1-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KSP1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KWU3", "url": "https://www.uniprot.org/uniprot/A0A8I5KWU3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KWU3-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KWU3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH50", "url": "https://www.uniprot.org/uniprot/E5RH50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH50-1", "url": "https://www.uniprot.org/uniprot/E5RH50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHK4", "url": "https://www.uniprot.org/uniprot/E5RHK4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHK4-1", "url": "https://www.uniprot.org/uniprot/E5RHK4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAN4", "url": "https://www.uniprot.org/uniprot/H0YAN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAN4-1", "url": "https://www.uniprot.org/uniprot/H0YAN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAX9", "url": "https://www.uniprot.org/uniprot/H0YAX9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAX9-1", "url": "https://www.uniprot.org/uniprot/H0YAX9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBJ5", "url": "https://www.uniprot.org/uniprot/H0YBJ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBJ5-1", "url": "https://www.uniprot.org/uniprot/H0YBJ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBM7", "url": "https://www.uniprot.org/uniprot/H0YBM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBM7-1", "url": "https://www.uniprot.org/uniprot/H0YBM7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBR8", "url": "https://www.uniprot.org/uniprot/H0YBR8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBR8-1", "url": "https://www.uniprot.org/uniprot/H0YBR8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBW1", "url": "https://www.uniprot.org/uniprot/H0YBW1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBW1-1", "url": "https://www.uniprot.org/uniprot/H0YBW1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC33", "url": "https://www.uniprot.org/uniprot/H0YC33", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC33-1", "url": "https://www.uniprot.org/uniprot/H0YC33-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC73", "url": "https://www.uniprot.org/uniprot/H0YC73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC73-1", "url": "https://www.uniprot.org/uniprot/H0YC73-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PKG0-1", "url": "https://www.uniprot.org/uniprot/Q6PKG0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PKG0-3", "url": "https://www.uniprot.org/uniprot/Q6PKG0-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK", "length": 1096, "header": "sp|Q6PKG0-1|LARP1_HUMAN Isoform 1 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 CANONICAL=Q6PKG0-1" }, "isoforms": [ { "isoform_ac": "A0A0B4J210-1", "url": "", "sequence": { "sequence": "MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMP", "length": 815, "header": "tr|A0A0B4J210-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=5 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154814093, "end_pos": 154755758, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518297", "url": "https://www.ensembl.org/id/ENST00000518297" }, { "database": "Ensembl Peptide", "id": "ENSP00000428589", "url": "https://www.ensembl.org/id/ENSP00000428589" } ] } }, { "isoform_ac": "A0A8I5KSP1-1", "url": "", "sequence": { "sequence": "MKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK", "length": 858, "header": "tr|A0A8I5KSP1-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154814093, "end_pos": 154792673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000687700.1", "url": "https://www.ensembl.org/id/ENST00000687700.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508958.1", "url": "https://www.ensembl.org/id/ENSP00000508958.1" } ] } }, { "isoform_ac": "A0A8I5KWU3-1", "url": "", "sequence": { "sequence": "MKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK", "length": 891, "header": "tr|A0A8I5KWU3-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154814093, "end_pos": 154792673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000685946.1", "url": "https://www.ensembl.org/id/ENST00000685946.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000509794.1", "url": "https://www.ensembl.org/id/ENSP00000509794.1" } ] } }, { "isoform_ac": "E5RH50-1", "url": "", "sequence": { "sequence": "MKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMP", "length": 610, "header": "tr|E5RH50-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=8 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154804206, "end_pos": 154792673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000524248.5", "url": "https://www.ensembl.org/id/ENST00000524248.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429904.1", "url": "https://www.ensembl.org/id/ENSP00000429904.1" } ] } }, { "isoform_ac": "E5RHK4-1", "url": "", "sequence": { "sequence": "MKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYV", "length": 92, "header": "tr|E5RHK4-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=8 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154793822, "end_pos": 154792673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519931.5", "url": "https://www.ensembl.org/id/ENST00000519931.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429710.1", "url": "https://www.ensembl.org/id/ENSP00000429710.1" } ] } }, { "isoform_ac": "H0YAN4-1", "url": "", "sequence": { "sequence": "XRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAAHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYY", "length": 150, "header": "tr|H0YAN4-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154795186, "end_pos": 154792774, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518194.1", "url": "https://www.ensembl.org/id/ENST00000518194.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000427731.1", "url": "https://www.ensembl.org/id/ENSP00000427731.1" } ] } }, { "isoform_ac": "H0YAX9-1", "url": "", "sequence": { "sequence": "XNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQMKLLRLAEVNY", "length": 61, "header": "tr|H0YAX9-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154791980, "end_pos": 154756174, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521577.1", "url": "https://www.ensembl.org/id/ENST00000521577.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428251.1", "url": "https://www.ensembl.org/id/ENSP00000428251.1" } ] } }, { "isoform_ac": "H0YBJ5-1", "url": "", "sequence": { "sequence": "XGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPDTL", "length": 67, "header": "tr|H0YBJ5-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154786486, "end_pos": 154756003, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518892.1", "url": "https://www.ensembl.org/id/ENST00000518892.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429624.1", "url": "https://www.ensembl.org/id/ENSP00000429624.1" } ] } }, { "isoform_ac": "H0YBM7-1", "url": "", "sequence": { "sequence": "XRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVP", "length": 167, "header": "tr|H0YBM7-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154793649, "end_pos": 154755985, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000517616.5", "url": "https://www.ensembl.org/id/ENST00000517616.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429852.1", "url": "https://www.ensembl.org/id/ENSP00000429852.1" } ] } }, { "isoform_ac": "H0YBR8-1", "url": "", "sequence": { "sequence": "XRHSSNPPLESHVGWVMDSREHRPRTASIRDGTDCK", "length": 36, "header": "tr|H0YBR8-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154804881, "end_pos": 154804221, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522272.1", "url": "https://www.ensembl.org/id/ENST00000522272.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430169.1", "url": "https://www.ensembl.org/id/ENSP00000430169.1" } ] } }, { "isoform_ac": "H0YBW1-1", "url": "", "sequence": { "sequence": "DESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKAHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKK", "length": 281, "header": "tr|H0YBW1-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154800042, "end_pos": 154792733, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523163.5", "url": "https://www.ensembl.org/id/ENST00000523163.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430438.1", "url": "https://www.ensembl.org/id/ENSP00000430438.1" } ] } }, { "isoform_ac": "H0YC33-1", "url": "", "sequence": { "sequence": "XQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISKMAPVCVSCFPKQALRATYL", "length": 183, "header": "tr|H0YC33-1|H0YC33_HUMAN Computationally mapped isoform of La ribonucleoprotein 1, translational regulator OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154804835, "end_pos": 154802350, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518677.1", "url": "https://www.ensembl.org/id/ENST00000518677.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430815.1", "url": "https://www.ensembl.org/id/ENSP00000430815.1" } ] } }, { "isoform_ac": "H0YC73-1", "url": "", "sequence": { "sequence": "ELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSK", "length": 195, "header": "tr|H0YC73-1|LARP1_HUMAN Computationally mapped isoform of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=1 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154802081, "end_pos": 154794210, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518742.1", "url": "https://www.ensembl.org/id/ENST00000518742.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000431072.1", "url": "https://www.ensembl.org/id/ENSP00000431072.1" } ] } }, { "isoform_ac": "Q6PKG0-1", "url": "", "sequence": { "sequence": "MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK", "length": 1096, "header": "sp|Q6PKG0-1|LARP1_HUMAN Isoform 1 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 CANONICAL=Q6PKG0-1" }, "locus": {} }, { "isoform_ac": "Q6PKG0-3", "url": "", "sequence": { "sequence": "MLWRVLLSKRPPFPHPELDFQEAPIPSCPGRLPGRKNSVALAAAPRKEPTGDREKPLPFPVLAPFSNPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK", "length": 1019, "header": "sp|Q6PKG0-3|LARP1_HUMAN Isoform 3 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 CANONICAL=Q6PKG0-1" }, "locus": { "chromosome": "5", "start_pos": 154814093, "end_pos": 154712926, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000336314.9", "url": "https://www.ensembl.org/id/ENST00000336314.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000336721.4", "url": "https://www.ensembl.org/id/ENSP00000336721.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 148, "start_aa": "Ser", "end_pos": 148, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser148", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "Q6PKG0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 584, "start_aa": "Ser", "end_pos": 584, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser584", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "Q6PKG0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 672, "start_aa": "Ser", "end_pos": 672, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser672", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "Q6PKG0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 766, "start_aa": "Ser", "end_pos": 766, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser766", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 769, "start_aa": "Thr", "end_pos": 769, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr769", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 770, "start_aa": "Thr", "end_pos": 770, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr770", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "Q6PKG0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 809, "start_aa": "Thr", "end_pos": 809, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr809", "evidence": [ { "id": "Q6PKG0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "37070251", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37070251" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "Q6PKG0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ] } ], "phosphorylation": [ { "start_pos": 1040, "end_pos": 1040, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser1040" }, { "start_pos": 1056, "end_pos": 1056, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ], "site_lbl": "Ser1056" }, { "start_pos": 1056, "end_pos": 1056, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ], "site_lbl": "Ser1056" }, { "start_pos": 1058, "end_pos": 1058, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser1058" }, { "start_pos": 1071, "end_pos": 1071, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ], "site_lbl": "Thr1071" }, { "start_pos": 1089, "end_pos": 1089, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser1089" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser143" }, { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser165" }, { "start_pos": 215, "end_pos": 215, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser215" }, { "start_pos": 220, "end_pos": 220, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser220" }, { "start_pos": 223, "end_pos": 223, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "site_lbl": "Thr223" }, { "start_pos": 225, "end_pos": 225, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "site_lbl": "Ser225" }, { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "site_lbl": "Ser228" }, { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Thr303" }, { "start_pos": 324, "end_pos": 324, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "site_lbl": "Ser324" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "site_lbl": "Ser327" }, { "start_pos": 376, "end_pos": 376, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Thr376" }, { "start_pos": 379, "end_pos": 379, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Tyr379" }, { "start_pos": 393, "end_pos": 393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr393" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Ser517" }, { "start_pos": 521, "end_pos": 521, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ], "site_lbl": "Ser521" }, { "start_pos": 526, "end_pos": 526, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Thr526" }, { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser546" }, { "start_pos": 548, "end_pos": 548, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser548" }, { "start_pos": 591, "end_pos": 591, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser591" }, { "start_pos": 622, "end_pos": 622, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr622" }, { "start_pos": 624, "end_pos": 624, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Thr624" }, { "start_pos": 627, "end_pos": 627, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Ser627" }, { "start_pos": 631, "end_pos": 631, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser631" }, { "start_pos": 633, "end_pos": 633, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Tyr633" }, { "start_pos": 649, "end_pos": 649, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Thr649" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr68" }, { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr722" }, { "start_pos": 724, "end_pos": 724, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Thr724" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser75" }, { "start_pos": 766, "end_pos": 766, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser766" }, { "start_pos": 769, "end_pos": 769, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr769" }, { "start_pos": 770, "end_pos": 770, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr770" }, { "start_pos": 774, "end_pos": 774, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Ser774" }, { "start_pos": 774, "end_pos": 774, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser774" }, { "start_pos": 777, "end_pos": 777, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Tyr777" }, { "start_pos": 782, "end_pos": 782, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Thr782" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Thr785" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr788" }, { "start_pos": 797, "end_pos": 797, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Thr797" }, { "start_pos": 823, "end_pos": 823, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser823" }, { "start_pos": 824, "end_pos": 824, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser824" }, { "start_pos": 830, "end_pos": 830, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser830" }, { "start_pos": 838, "end_pos": 838, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser838" }, { "start_pos": 845, "end_pos": 845, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr845" }, { "start_pos": 847, "end_pos": 847, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ], "site_lbl": "Ser847" }, { "start_pos": 847, "end_pos": 847, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser847" }, { "start_pos": 849, "end_pos": 849, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser849" }, { "start_pos": 850, "end_pos": 850, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser850" }, { "start_pos": 851, "end_pos": 851, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser851" }, { "start_pos": 853, "end_pos": 853, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser853" }, { "start_pos": 861, "end_pos": 861, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser861" }, { "start_pos": 862, "end_pos": 862, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Tyr862" }, { "start_pos": 865, "end_pos": 865, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr865" }, { "start_pos": 868, "end_pos": 868, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser868" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "17693683", "url": "https://glygen.org/publication/PubMed/17693683" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "phospho.ELM", "id": "Q6PKG0", "url": "http://phospho.elm.eu.org/byAccession/Q6PKG0.html" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "site_lbl": "Ser90" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang L, Manji GA, Grenier JM, Al-Garawi A, Merriam S, Lora JM, Geddes BJ, Briskin M, DiStefano PS, Bertin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12019269", "url": "https://glygen.org/publication/PubMed/12019269" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "Cutting edge: Monarch-1: a pyrin/nucleotide-binding domain/leucine-rich repeat protein that controls classical and nonclassical MHC class I genes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Williams KL, Taxman DJ, Linhoff MW, Reed W, Ting JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12759408", "url": "https://glygen.org/publication/PubMed/12759408" } ] }, { "title": "Nuclear trafficking of La protein depends on a newly identified nucleolar localization signal and the ability to bind RNA.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Horke S, Reumann K, Schweizer M, Will H, Heise T", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "15060081", "url": "https://glygen.org/publication/PubMed/15060081" } ] }, { "title": "The RNA helicase RIG-I has an essential function in double-stranded RNA-induced innate antiviral responses.", "journal": "Nature immunology", "date": "2004", "authors": "Yoneyama M, Kikuchi M, Natsukawa T, Shinobu N, Imaizumi T, Miyagishi M, Taira K, Akira S, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "15208624", "url": "https://glygen.org/publication/PubMed/15208624" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "UniProtKB", "id": "H0YC73", "url": "https://www.uniprot.org/uniprot/H0YC73" }, { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "H0YBW1", "url": "https://www.uniprot.org/uniprot/H0YBW1" }, { "database": "UniProtKB", "id": "E5RH50", "url": "https://www.uniprot.org/uniprot/E5RH50" }, { "database": "UniProtKB", "id": "H0YC33", "url": "https://www.uniprot.org/uniprot/H0YC33" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "17693683", "url": "https://glygen.org/publication/PubMed/17693683" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "E5RH50", "url": "https://www.uniprot.org/uniprot/E5RH50" }, { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Phosphoproteome of resting human platelets.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "UniProtKB", "id": "H0YBR8", "url": "https://www.uniprot.org/uniprot/H0YBR8" }, { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "H0YC33", "url": "https://www.uniprot.org/uniprot/H0YC33" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "UniProtKB", "id": "H0YC73", "url": "https://www.uniprot.org/uniprot/H0YC73" }, { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "H0YBW1", "url": "https://www.uniprot.org/uniprot/H0YBW1" }, { "database": "UniProtKB", "id": "E5RH50", "url": "https://www.uniprot.org/uniprot/E5RH50" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Large-scale proteomics analysis of the human kinome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The RNA binding protein Larp1 regulates cell division, apoptosis and cell migration.", "journal": "Nucleic Acids Res.", "date": "2010", "authors": "Burrows C, Abd Latip N, Lam SJ, Carpenter L, Sawicka K, Tzolovsky G, Gabra H, Bushell M, Glover DM, Willis AE, Blagden SP", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "20430826", "url": "https://glygen.org/publication/PubMed/20430826" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Large-scale discovery of ERK2 substrates identifies ERK-mediated transcriptional regulation by ETV3.", "journal": "Science signaling", "date": "2011", "authors": "Carlson SM, Chouinard CR, Labadorf A, Lam CJ, Schmelzle K, Fraenkel E, White FM", "evidence": [ { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ] }, { "title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "LARP1 specifically recognizes the 3' terminus of poly(A) mRNA.", "journal": "FEBS Lett.", "date": "2013", "authors": "Aoki K., Natsume T., Koike K., Adachi S., Homoto M., Kusano H.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "23711370", "url": "https://glygen.org/publication/PubMed/23711370" } ] }, { "title": "LARP1 predict the prognosis for early-stage and AFP-normal hepatocellular carcinoma.", "journal": "J. Transl. Med.", "date": "2013", "authors": "Wang P., Zhang G., Huang L., Gao Z., Xie S., Peng L., Xie D., Xie C.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "24159927", "url": "https://glygen.org/publication/PubMed/24159927" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Proteomic analysis of cap-dependent translation identifies LARP1 as a key regulator of 5'TOP mRNA translation.", "journal": "Genes Dev.", "date": "2014", "authors": "Gygi S.P., Lavoie G., Roux P.P., Huttlin E.L., Tcherkezian J., Cargnello M., Romeo Y.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "24532714", "url": "https://glygen.org/publication/PubMed/24532714" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4J210", "url": "https://www.uniprot.org/uniprot/A0A0B4J210" }, { "database": "UniProtKB", "id": "H0YAN4", "url": "https://www.uniprot.org/uniprot/H0YAN4" }, { "database": "UniProtKB", "id": "E5RH50", "url": "https://www.uniprot.org/uniprot/E5RH50" }, { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "La-related protein 1 (LARP1) represses terminal oligopyrimidine (TOP) mRNA translation downstream of mTOR complex 1 (mTORC1).", "journal": "J. Biol. Chem.", "date": "2015", "authors": "Fonseca BD, Zakaria C, Jia JJ, Graber TE, Svitkin Y, Tahmasebi S, Healy D, Hoang HD, Jensen JM, Diao IT, Lussier A, Dajadian C, Padmanabhan N, Wang W, Matta-Camacho E, Hearnden J, Smith EM, Tsukumo Y, Yanagiya A, Morita M, Petroulakis E, Gonzalez JL, Hernandez G, Alain T, Damgaard CK", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "title": "The La-related protein 1-specific domain repurposes HEAT-like repeats to directly bind a 5'TOP sequence.", "journal": "Nucleic Acids Res.", "date": "2015", "authors": "Lahr RM, Mack SM, Heroux A, Blagden SP, Bousquet-Antonelli C, Deragon JM, Berman AJ", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "26206669", "url": "https://glygen.org/publication/PubMed/26206669" } ] }, { "title": "Characterization of RyDEN (C19orf66) as an interferon-stimulated cellular inhibitor against dengue virus replication.", "journal": "PLoS Pathog.", "date": "2016", "authors": "Suzuki Y, Chin WX, Han Q, Ichiyama K, Lee CH, Eyo ZW, Ebina H, Takahashi H, Takahashi C, Tan BH, Hishiki T, Ohba K, Matsuyama T, Koyanagi Y, Tan YJ, Sawasaki T, Chu JJ, Vasudevan SG, Sano K, Yamamoto N", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "26735137", "url": "https://glygen.org/publication/PubMed/26735137" } ] }, { "title": "LARP1 functions as a molecular switch for mTORC1-mediated translation of an essential class of mRNAs.", "journal": "eLife", "date": "2017", "authors": "Hong S, Freeberg MA, Han T, Kamath A, Yao Y, Fukuda T, Suzuki T, Kim JK, Inoki K", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "iPTMnet", "id": "Q6PKG0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "O-GlcNAc Atlas", "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Autogenous Control of 5'TOP mRNA Stability by 40S Ribosomes.", "journal": "Mol. Cell", "date": "2017", "authors": "Thomas G., Pelletier J., Castano J., Bueno C., Ruiz M., Kozma S.C., Fuentes P., Gentilella A., Menendez P., Moron-Duran F.D., Riano-Canalias F., Tauler A., Turon G., Zweig-Rocha G.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "28673543", "url": "https://glygen.org/publication/PubMed/28673543" } ] }, { "title": "La-related protein 1 (LARP1) repression of TOP mRNA translation is mediated through its cap-binding domain and controlled by an adjacent regulatory region.", "journal": "Nucleic Acids Res.", "date": "2018", "authors": "Philippe L, Vasseur JJ, Debart F, Thoreen CC", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "29244122", "url": "https://glygen.org/publication/PubMed/29244122" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "O-GlcNAc Atlas", "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "O-GlcNAc Atlas", "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "O-GlcNAc Atlas", "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "Global profiling of O-GlcNAcylated and/or phosphorylated proteins in hepatoblastoma.", "journal": "Signal transduction and targeted therapy", "date": "2019", "authors": "Song H, Ma J, Bian Z, Chen S, Zhu J, Wang J, Huang N, Yin M, Sun F, Xu M, Pan Q", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "O-GlcNAc Atlas", "id": "Q6PKG0", "url": "https://oglcnac.org/atlas/detail/Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "31637018", "url": "https://glygen.org/publication/PubMed/31637018" } ] }, { "title": "ZBP1 and TAK1: Master Regulators of NLRP3 Inflammasome/Pyroptosis, Apoptosis, and Necroptosis (PAN-optosis).", "journal": "Frontiers in cellular and infection microbiology", "date": "2019", "authors": "Malireddi RKS, Kesavardhana S, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "31850239", "url": "https://glygen.org/publication/PubMed/31850239" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "A SARS-CoV-2 protein interaction map reveals targets for drug repurposing.", "journal": "Nature", "date": "2020", "authors": "Gordon DE, Jang GM, Bouhaddou M, Xu J, Obernier K, White KM, O'Meara MJ, Rezelj VV, Guo JZ, Swaney DL, Tummino TA, Huttenhain R, Kaake RM, Richards AL, Tutuncuoglu B, Foussard H, Batra J, Haas K, Modak M, Kim M, Haas P, Polacco BJ, Braberg H, Fabius JM, Eckhardt M, Soucheray M, Bennett MJ, Cakir M, McGregor MJ, Li Q, Meyer B, Roesch F, Vallet T, Mac Kain A, Miorin L, Moreno E, Naing ZZC, Zhou Y, Peng S, Shi Y, Zhang Z, Shen W, Kirby IT, Melnyk JE, Chorba JS, Lou K, Dai SA, Barrio-Hernandez I, Memon D, Hernandez-Armenta C, Lyu J, Mathy CJP, Perica T, Pilla KB, Ganesan SJ, Saltzberg DJ, Rakesh R, Liu X, Rosenthal SB, Calviello L, Venkataramanan S, Liboy-Lugo J, Lin Y, Huang XP, Liu Y, Wankowicz SA, Bohn M, Safari M, Ugur FS, Koh C, Savar NS, Tran QD, Shengjuler D, Fletcher SJ, O'Neal MC, Cai Y, Chang JCJ, Broadhurst DJ, Klippsten S, Sharp PP, Wenzell NA, Kuzuoglu-Ozturk D, Wang HY, Trenker R, Young JM, Cavero DA, Hiatt J, Roth TL, Rathore U, Subramanian A, Noack J, Hubert M, Stroud RM, Frankel AD, Rosenberg OS, Verba KA, Agard DA, Ott M, Emerman M, Jura N, von Zastrow M, Verdin E, Ashworth A, Schwartz O, d'Enfert C, Mukherjee S, Jacobson M, Malik HS, Fujimori DG, Ideker T, Craik CS, Floor SN, Fraser JS, Gross JD, Sali A, Roth BL, Ruggero D, Taunton J, Kortemme T, Beltrao P, Vignuzzi M, Garcia-Sastre A, Shokat KM, Shoichet BK, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32353859", "url": "https://glygen.org/publication/PubMed/32353859" } ] }, { "title": "Characterization and Noncovalent Inhibition of the Deubiquitinase and deISGylase Activity of SARS-CoV-2 Papain-Like Protease.", "journal": "ACS infectious diseases", "date": "2020", "authors": "Freitas BT, Durie IA, Murray J, Longo JE, Miller HC, Crich D, Hogan RJ, Tripp RA, Pegan SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32428392", "url": "https://glygen.org/publication/PubMed/32428392" } ] }, { "title": "The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway.", "journal": "Virus research", "date": "2020", "authors": "Li JY, Liao CH, Wang Q, Tan YJ, Luo R, Qiu Y, Ge XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32589897", "url": "https://glygen.org/publication/PubMed/32589897" } ] }, { "title": "Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity.", "journal": "Nature", "date": "2020", "authors": "Shin D, Mukherjee R, Grewe D, Bojkova D, Baek K, Bhattacharya A, Schulz L, Widera M, Mehdipour AR, Tascher G, Geurink PP, Wilhelm A, van der Heden van Noort GJ, Ovaa H, Muller S, Knobeloch KP, Rajalingam K, Schulman BA, Cinatl J, Hummer G, Ciesek S, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32726803", "url": "https://glygen.org/publication/PubMed/32726803" } ] }, { "title": "SARS-CoV-2 Orf9b suppresses type I interferon responses by targeting TOM70.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Jiang HW, Zhang HN, Meng QF, Xie J, Li Y, Chen H, Zheng YX, Wang XN, Qi H, Zhang J, Wang PH, Han ZG, Tao SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32728199", "url": "https://glygen.org/publication/PubMed/32728199" } ] }, { "title": "SARS-CoV-2 N protein antagonizes type I interferon signaling by suppressing phosphorylation and nuclear translocation of STAT1 and STAT2.", "journal": "Cell discovery", "date": "2020", "authors": "Mu J, Fang Y, Yang Q, Shu T, Wang A, Huang M, Jin L, Deng F, Qiu Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32953130", "url": "https://glygen.org/publication/PubMed/32953130" } ] }, { "title": "Evasion of Type I Interferon by SARS-CoV-2.", "journal": "Cell reports", "date": "2020", "authors": "Xia H, Cao Z, Xie X, Zhang X, Chen JY, Wang H, Menachery VD, Rajsbaum R, Shi PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32979938", "url": "https://glygen.org/publication/PubMed/32979938" } ] }, { "title": "Main protease of SARS-CoV-2 serves as a bifunctional molecule in restricting type I interferon antiviral signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Wu Y, Ma L, Zhuang Z, Cai S, Zhao Z, Zhou L, Zhang J, Wang PH, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33024073", "url": "https://glygen.org/publication/PubMed/33024073" } ] }, { "title": "Comparative host-coronavirus protein interaction networks reveal pan-viral disease mechanisms.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Gordon DE, Hiatt J, Bouhaddou M, Rezelj VV, Ulferts S, Braberg H, Jureka AS, Obernier K, Guo JZ, Batra J, Kaake RM, Weckstein AR, Owens TW, Gupta M, Pourmal S, Titus EW, Cakir M, Soucheray M, McGregor M, Cakir Z, Jang G, O'Meara MJ, Tummino TA, Zhang Z, Foussard H, Rojc A, Zhou Y, Kuchenov D, Huttenhain R, Xu J, Eckhardt M, Swaney DL, Fabius JM, Ummadi M, Tutuncuoglu B, Rathore U, Modak M, Haas P, Haas KM, Naing ZZC, Pulido EH, Shi Y, Barrio-Hernandez I, Memon D, Petsalaki E, Dunham A, Marrero MC, Burke D, Koh C, Vallet T, Silvas JA, Azumaya CM, Billesbolle C, Brilot AF, Campbell MG, Diallo A, Dickinson MS, Diwanji D, Herrera N, Hoppe N, Kratochvil HT, Liu Y, Merz GE, Moritz M, Nguyen HC, Nowotny C, Puchades C, Rizo AN, Schulze-Gahmen U, Smith AM, Sun M, Young ID, Zhao J, Asarnow D, Biel J, Bowen A, Braxton JR, Chen J, Chio CM, Chio US, Deshpande I, Doan L, Faust B, Flores S, Jin M, Kim K, Lam VL, Li F, Li J, Li YL, Li Y, Liu X, Lo M, Lopez KE, Melo AA, Moss FR 3rd, Nguyen P, Paulino J, Pawar KI, Peters JK, Pospiech TH Jr, Safari M, Sangwan S, Schaefer K, Thomas PV, Thwin AC, Trenker R, Tse E, Tsui TKM, Wang F, Whitis N, Yu Z, Zhang K, Zhang Y, Zhou F, Saltzberg D, Hodder AJ, Shun-Shion AS, Williams DM, White KM, Rosales R, Kehrer T, Miorin L, Moreno E, Patel AH, Rihn S, Khalid MM, Vallejo-Gracia A, Fozouni P, Simoneau CR, Roth TL, Wu D, Karim MA, Ghoussaini M, Dunham I, Berardi F, Weigang S, Chazal M, Park J, Logue J, McGrath M, Weston S, Haupt R, Hastie CJ, Elliott M, Brown F, Burness KA, Reid E, Dorward M, Johnson C, Wilkinson SG, Geyer A, Giesel DM, Baillie C, Raggett S, Leech H, Toth R, Goodman N, Keough KC, Lind AL, Klesh RJ, Hemphill KR, Carlson-Stevermer J, Oki J, Holden K, Maures T, Pollard KS, Sali A, Agard DA, Cheng Y, Fraser JS, Frost A, Jura N, Kortemme T, Manglik A, Southworth DR, Stroud RM, Alessi DR, Davies P, Frieman MB, Ideker T, Abate C, Jouvenet N, Kochs G, Shoichet B, Ott M, Palmarini M, Shokat KM, Garcia-Sastre A, Rassen JA, Grosse R, Rosenberg OS, Verba KA, Basler CF, Vignuzzi M, Peden AA, Beltrao P, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33060197", "url": "https://glygen.org/publication/PubMed/33060197" } ] }, { "title": "SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Miorin L, Kehrer T, Sanchez-Aparicio MT, Zhang K, Cohen P, Patel RS, Cupic A, Makio T, Mei M, Moreno E, Danziger O, White KM, Rathnasinghe R, Uccellini M, Gao S, Aydillo T, Mena I, Yin X, Martin-Sancho L, Krogan NJ, Chanda SK, Schotsaert M, Wozniak RW, Ren Y, Rosenberg BR, Fontoura BMA, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33097660", "url": "https://glygen.org/publication/PubMed/33097660" } ] }, { "title": "SARS-CoV-2 membrane glycoprotein M antagonizes the MAVS-mediated innate antiviral response.", "journal": "Cellular & molecular immunology", "date": "2021", "authors": "Fu YZ, Wang SY, Zheng ZQ, Yi Huang, Li WW, Xu ZS, Wang YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33110251", "url": "https://glygen.org/publication/PubMed/33110251" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "The SARS-CoV-2 RNA-protein interactome in infected human cells.", "journal": "Nature microbiology", "date": "2021", "authors": "Schmidt N, Lareau CA, Keshishian H, Ganskih S, Schneider C, Hennig T, Melanson R, Werner S, Wei Y, Zimmer M, Ade J, Kirschner L, Zielinski S, Dolken L, Lander ES, Caliskan N, Fischer U, Vogel J, Carr SA, Bodem J, Munschauer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33349665", "url": "https://glygen.org/publication/PubMed/33349665" } ] }, { "title": "Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Kato K, Ikliptikawati DK, Kobayashi A, Kondo H, Lim K, Hazawa M, Wong RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33360543", "url": "https://glygen.org/publication/PubMed/33360543" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) membrane (M) protein inhibits type I and III interferon production by targeting RIG-I/MDA-5 signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Zheng Y, Zhuang MW, Han L, Zhang J, Nan ML, Zhan P, Kang D, Liu X, Gao C, Wang PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372174", "url": "https://glygen.org/publication/PubMed/33372174" } ] }, { "title": "SARS-CoV-2 proteases PLpro and 3CLpro cleave IRF3 and critical modulators of inflammatory pathways (NLRP12 and TAB1): implications for disease presentation across species.", "journal": "Emerging microbes & infections", "date": "2021", "authors": "Moustaqil M, Ollivier E, Chiu HP, Van Tol S, Rudolffi-Soto P, Stevens C, Bhumkar A, Hunter DJB, Freiberg AN, Jacques D, Lee B, Sierecki E, Gambin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372854", "url": "https://glygen.org/publication/PubMed/33372854" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Interacts with RIG-I and Represses RIG-Mediated IFN-beta Production.", "journal": "Viruses", "date": "2020", "authors": "Chen K, Xiao F, Hu D, Ge W, Tian M, Wang W, Pan P, Wu K, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33396605", "url": "https://glygen.org/publication/PubMed/33396605" } ] }, { "title": "MDA5 Governs the Innate Immune Response to SARS-CoV-2 in Lung Epithelial Cells.", "journal": "Cell reports", "date": "2021", "authors": "Yin X, Riva L, Pu Y, Martin-Sancho L, Kanamune J, Yamamoto Y, Sakai K, Gotoh S, Miorin L, De Jesus PD, Yang CC, Herbert KM, Yoh S, Hultquist JF, Garcia-Sastre A, Chanda SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33440148", "url": "https://glygen.org/publication/PubMed/33440148" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein undergoes liquid-liquid phase separation into stress granules through its N-terminal intrinsically disordered region.", "journal": "Cell discovery", "date": "2021", "authors": "Wang J, Shi C, Xu Q, Yin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33479219", "url": "https://glygen.org/publication/PubMed/33479219" } ] }, { "title": "The RNA-binding protein LARP1 is dispensable for pancreatic beta-cell function and mass.", "journal": "Scientific reports", "date": "2021", "authors": "Werneck-de-Castro JP, Pecanha FLM, Silvestre DH, Bernal-Mizrachi E", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "33483593", "url": "https://glygen.org/publication/PubMed/33483593" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production.", "journal": "Science bulletin", "date": "2021", "authors": "Luo L, Li Z, Zhao T, Ju X, Ma P, Jin B, Zhou Y, He S, Huang J, Xu X, Zou Y, Li P, Liang A, Liu J, Chi T, Huang X, Ding Q, Jin Z, Huang C, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33495715", "url": "https://glygen.org/publication/PubMed/33495715" } ] }, { "title": "SARS-CoV-2 triggers an MDA-5-dependent interferon response which is unable to control replication in lung epithelial cells.", "journal": "Journal of virology", "date": "2021", "authors": "Rebendenne A, Valadao ALC, Tauziet M, Maarifi G, Bonaventure B, McKellar J, Planes R, Nisole S, Arnaud-Arnould M, Moncorge O, Goujon C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33514628", "url": "https://glygen.org/publication/PubMed/33514628" } ] }, { "title": "SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO.", "journal": "Cell reports", "date": "2021", "authors": "Wu J, Shi Y, Pan X, Wu S, Hou R, Zhang Y, Zhong T, Tang H, Du W, Wang L, Wo J, Mu J, Qiu Y, Yang K, Zhang LK, Ye BC, Qi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33567255", "url": "https://glygen.org/publication/PubMed/33567255" } ] }, { "title": "SARS-CoV-2, SARS-CoV-1, and HIV-1 derived ssRNA sequences activate the NLRP3 inflammasome in human macrophages through a non-classical pathway.", "journal": "iScience", "date": "2021", "authors": "Campbell GR, To RK, Hanna J, Spector SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33718825", "url": "https://glygen.org/publication/PubMed/33718825" } ] }, { "title": "Unique and complementary suppression of cGAS-STING and RNA sensing- triggered innate immune responses by SARS-CoV-2 proteins.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Rui Y, Su J, Shen S, Hu Y, Huang D, Zheng W, Lou M, Shi Y, Wang M, Chen S, Zhao N, Dong Q, Cai Y, Xu R, Zheng S, Yu XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723219", "url": "https://glygen.org/publication/PubMed/33723219" } ] }, { "title": "ORF8 contributes to cytokine storm during SARS-CoV-2 infection by activating IL-17 pathway.", "journal": "iScience", "date": "2021", "authors": "Lin X, Fu B, Yin S, Li Z, Liu H, Zhang H, Xing N, Wang Y, Xue W, Xiong Y, Zhang S, Zhao Q, Xu S, Zhang J, Wang P, Nian W, Wang X, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723527", "url": "https://glygen.org/publication/PubMed/33723527" } ] }, { "title": "ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity.", "journal": "Nature microbiology", "date": "2021", "authors": "Liu G, Lee JH, Parker ZM, Acharya D, Chiang JJ, van Gent M, Riedl W, Davis-Gardner ME, Wies E, Chiang C, Gack MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33727702", "url": "https://glygen.org/publication/PubMed/33727702" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Targets RIG-I-Like Receptor Pathways to Inhibit the Induction of Interferon Response.", "journal": "Cells", "date": "2021", "authors": "Oh SJ, Shin OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33801464", "url": "https://glygen.org/publication/PubMed/33801464" } ] }, { "title": "CNBP Binds and Unfolds In Vitro G-Quadruplexes Formed in the SARS-CoV-2 Positive and Negative Genome Strands.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Bezzi G, Piga EJ, Binolfi A, Armas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33807682", "url": "https://glygen.org/publication/PubMed/33807682" } ] }, { "title": "SARS-CoV-2 ORF6 Disrupts Bidirectional Nucleocytoplasmic Transport through Interactions with Rae1 and Nup98.", "journal": "mBio", "date": "2021", "authors": "Addetia A, Lieberman NAP, Phung Q, Hsiang TY, Xie H, Roychoudhury P, Shrestha L, Loprieno MA, Huang ML, Gale M Jr, Jerome KR, Greninger AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "title": "RNA-induced liquid phase separation of SARS-CoV-2 nucleocapsid protein facilitates NF-kappaB hyper-activation and inflammation.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Wu Y, Ma L, Cai S, Zhuang Z, Zhao Z, Jin S, Xie W, Zhou L, Zhang L, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33895773", "url": "https://glygen.org/publication/PubMed/33895773" } ] }, { "title": "TLR2 senses the SARS-CoV-2 envelope protein to produce inflammatory cytokines.", "journal": "Nature immunology", "date": "2021", "authors": "Zheng M, Karki R, Williams EP, Yang D, Fitzpatrick E, Vogel P, Jonsson CB, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33963333", "url": "https://glygen.org/publication/PubMed/33963333" } ] }, { "title": "The SARS-CoV-2 RNA interactome.", "journal": "Molecular cell", "date": "2021", "authors": "Lee S, Lee YS, Choi Y, Son A, Park Y, Lee KM, Kim J, Kim JS, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" }, { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "33989516", "url": "https://glygen.org/publication/PubMed/33989516" } ] }, { "title": "Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions.", "journal": "Nature communications", "date": "2021", "authors": "Gao X, Zhu K, Qin B, Olieric V, Wang M, Cui S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33990585", "url": "https://glygen.org/publication/PubMed/33990585" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "The ORF8 protein of SARS-CoV-2 mediates immune evasion through down-regulating MHC-Iota.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang Y, Chen Y, Li Y, Huang F, Luo B, Yuan Y, Xia B, Ma X, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Yan S, Wu L, Pan T, Zhang X, Li R, Huang W, He X, Xiao F, Zhang J, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34021074", "url": "https://glygen.org/publication/PubMed/34021074" } ] }, { "title": "Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Hsieh MH, Beirag N, Murugaiah V, Chou YC, Kuo WS, Kao HF, Madan T, Kishore U, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34054808", "url": "https://glygen.org/publication/PubMed/34054808" } ] }, { "title": "SARS-CoV-2 Membrane Protein Inhibits Type I Interferon Production Through Ubiquitin-Mediated Degradation of TBK1.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Sui L, Zhao Y, Wang W, Wu P, Wang Z, Yu Y, Hou Z, Tan G, Liu Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34084167", "url": "https://glygen.org/publication/PubMed/34084167" } ] }, { "title": "Conformational Dynamics in the Interaction of SARS-CoV-2 Papain-like Protease with Human Interferon-Stimulated Gene 15 Protein.", "journal": "The journal of physical chemistry letters", "date": "2021", "authors": "Leite WC, Weiss KL, Phillips G, Zhang Q, Qian S, Tsutakawa SE, Coates L, O'Neill H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34110168", "url": "https://glygen.org/publication/PubMed/34110168" } ] }, { "title": "SARS-CoV-2 viral proteins NSP1 and NSP13 inhibit interferon activation through distinct mechanisms.", "journal": "PloS one", "date": "2021", "authors": "Vazquez C, Swanson SE, Negatu SG, Dittmar M, Miller J, Ramage HR, Cherry S, Jurado KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34166398", "url": "https://glygen.org/publication/PubMed/34166398" } ] }, { "title": "Targeting liquid-liquid phase separation of SARS-CoV-2 nucleocapsid protein promotes innate antiviral immunity by elevating MAVS activity.", "journal": "Nature cell biology", "date": "2021", "authors": "Wang S, Dai T, Qin Z, Pan T, Chu F, Lou L, Zhang L, Yang B, Huang H, Lu H, Zhou F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34239064", "url": "https://glygen.org/publication/PubMed/34239064" } ] }, { "title": "Lectin Pathway Mediates Complement Activation by SARS-CoV-2 Proteins.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Ali YM, Ferrari M, Lynch NJ, Yaseen S, Dudler T, Gragerov S, Demopulos G, Heeney JL, Schwaeble WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34290717", "url": "https://glygen.org/publication/PubMed/34290717" } ] }, { "title": "SARS-CoV-2 N protein promotes NLRP3 inflammasome activation to induce hyperinflammation.", "journal": "Nature communications", "date": "2021", "authors": "Pan P, Shen M, Yu Z, Ge W, Chen K, Tian M, Xiao F, Wang Z, Wang J, Jia Y, Wang W, Wan P, Zhang J, Chen W, Lei Z, Chen X, Luo Z, Zhang Q, Xu M, Li G, Li Y, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34341353", "url": "https://glygen.org/publication/PubMed/34341353" } ] }, { "title": "SARS-CoV-2-associated ssRNAs activate inflammation and immunity via TLR7/8.", "journal": "JCI insight", "date": "2021", "authors": "Salvi V, Nguyen HO, Sozio F, Schioppa T, Gaudenzi C, Laffranchi M, Scapini P, Passari M, Barbazza I, Tiberio L, Tamassia N, Garlanda C, Del Prete A, Cassatella MA, Mantovani A, Sozzani S, Bosisio D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34375313", "url": "https://glygen.org/publication/PubMed/34375313" } ] }, { "title": "Molecular determinants for regulation of G3BP1/2 phase separation by the SARS-CoV-2 nucleocapsid protein.", "journal": "Cell discovery", "date": "2021", "authors": "Huang W, Ju X, Tian M, Li X, Yu Y, Sun Q, Ding Q, Jia D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34400613", "url": "https://glygen.org/publication/PubMed/34400613" } ] }, { "title": "Full-Length Recombinant hSP-D Binds and Inhibits SARS-CoV-2.", "journal": "Biomolecules", "date": "2021", "authors": "Arroyo R, Grant SN, Colombo M, Salvioni L, Corsi F, Truffi M, Ottolina D, Hurst B, Salzberg M, Prosperi D, Kingma PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34439781", "url": "https://glygen.org/publication/PubMed/34439781" } ] }, { "title": "SARS-CoV-2 N Protein Targets TRIM25-Mediated RIG-I Activation to Suppress Innate Immunity.", "journal": "Viruses", "date": "2021", "authors": "Gori Savellini G, Anichini G, Gandolfo C, Cusi MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34452305", "url": "https://glygen.org/publication/PubMed/34452305" } ] }, { "title": "A dual-role of SARS-CoV-2 nucleocapsid protein in regulating innate immune response.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao Y, Sui L, Wu P, Wang W, Wang Z, Yu Y, Hou Z, Tan G, Liu Q, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34471099", "url": "https://glygen.org/publication/PubMed/34471099" } ] }, { "title": "Phosphorylation of SARS-CoV-2 Orf9b Regulates Its Targeting to Two Binding Sites in TOM70 and Recruitment of Hsp90.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Brandherm L, Kobas AM, Klohn M, Bruggemann Y, Pfaender S, Rassow J, Kreimendahl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34502139", "url": "https://glygen.org/publication/PubMed/34502139" } ] }, { "title": "The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation.", "journal": "PLoS pathogens", "date": "2021", "authors": "Meyers JM, Ramanathan M, Shanderson RL, Beck A, Donohue L, Ferguson I, Guo MG, Rao DS, Miao W, Reynolds D, Yang X, Zhao Y, Yang YY, Blish C, Wang Y, Khavari PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34597346", "url": "https://glygen.org/publication/PubMed/34597346" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Global analysis of RNA-binding proteins identifies a positive feedback loop between LARP1 and MYC that promotes tumorigenesis.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2022", "authors": "Desi N, Tong QY, Teh V, Chan JJ, Zhang B, Tabatabaeian H, Tan HQ, Kapeli K, Jin W, Lim CY, Kwok ZH, Tan HT, Wang S, Siew BE, Lee KC, Chong CS, Tan KK, Yang H, Kappei D, Yeo GW, Chung MCM, Tay Y", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "35195778", "url": "https://glygen.org/publication/PubMed/35195778" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Binding of SARS-CoV-2 protein ORF9b to mitochondrial translocase TOM70 prevents its interaction with chaperone HSP90.", "journal": "Biochimie", "date": "2022-09", "authors": "Ayinde Kehinde S, Pinheiro Glaucia M S, Ramos Carlos H I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "35643212", "url": "https://glygen.org/publication/PubMed/35643212" } ] }, { "title": "Long non-coding RNA LINC01270 is an onco-promotor in lung adenocarcinoma by upregulating LARP1 via sponging miR-326.", "journal": "Bioengineered", "date": "2022-06", "authors": "Zhang Weiran, Cao Cheng, Shen Jingfu, Shan Shaoyin, Tong Yuanhao, Cai Hongyan, Han Zhifeng, Chai Huiping", "evidence": [ { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "36694453", "url": "https://glygen.org/publication/PubMed/36694453" } ] }, { "title": "O-GlcNAcylated LARP1 positively regulated by circCLNS1A facilitates hepatoblastoma progression through DKK4/\u03b2-catenin signalling.", "journal": "Clinical and translational medicine", "date": "2023-04", "authors": "Cui Zhongqi, He Jiangtu, Zhu Jiabei, Ni Wenxuan, Liu Li, Bian Zhixuan, Mao Siwei, Gu Song, Shan Yuhua, Chu Zhexuan, Wu Qi, Lu Jiayi, Liu Ya, Sun Fenyong, Pan Qiuhui, Zhang Yue, Huang Nan, Ma Ji", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6PKG0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PKG0" }, { "database": "RefSeq", "id": "NP_056130", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_056130" } ], "reference": [ { "type": "PubMed", "id": "37070251", "url": "https://glygen.org/publication/PubMed/37070251" } ] } ], "pathway": [ { "id": "hsa:23367", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:23367", "resource": "KEGG Pathway" }, { "id": "R-HSA-9705671", "name": "SARS-CoV-2 activates/modulates innate and adaptive immune responses", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "resource": "Reactome", "description": "SARS-CoV-2 activates/modulates innate and adaptive immune responses" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6ZQ58-1", "protein_name": "La-related protein 1", "gene_name": "Larp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATQVEPLLPAGAPLLQAEEHGLARKKPAPDAQAESGPGDGGGEPDGGVRRPRPACARPGRDGAERESPRPPAAAEAPAGSDGEDGGRRDFVEAPPPKVNPWTKHAPPPAAVNGQPPPEPSAPAKVVRAAAPKPRKGSKVGDFGDAVNWPTPGEIAHKSVQPQSHKPQPARKLPPKKDMKEQEKGDGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGSKHKWVPLQIDMKPEVPREKLASRPTRPQEPRHTPAVRGEMKGSEPATYMPVSVAPPTPAWQPETKVEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGTEGPRTHKYMNNITYYFDNVSSNEIYSMDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEMVEEKVRRREEPEKWPLPGPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSESWIEVKKRPRPSPARPKKPEEPRFSHPTALPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSEEDSDYEIDDRDVNKILIVTQTPPYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWTEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNARTPRTPRTPQLKDSSQTPRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPAVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHPVVAGGSGEGRKRCPSQSSSRPATGISQPPTTPTGQATREDAKWTSQHSDTLTLRK", "length": 1072 }, "evidence": [ { "id": "45225676", "url": "http://www.informatics.jax.org/homology/45225676", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "RNA cap binding", "id": "GO:0000339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000339", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "ribosomal small subunit binding", "id": "GO:0043024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043024", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "eukaryotic initiation factor 4E binding", "id": "GO:0008190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008190", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "translation activator activity", "id": "GO:0008494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008494", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "RNA 7-methylguanosine cap binding", "id": "GO:0000340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000340", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "mRNA 3'-UTR binding", "id": "GO:0003730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003730", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "mRNA 5'-UTR binding", "id": "GO:0048027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048027", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "translation initiation factor binding", "id": "GO:0031369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031369", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "mRNA stabilization", "id": "GO:0048255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048255", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cellular response to rapamycin", "id": "GO:0072752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072752", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cell population proliferation", "id": "GO:0008283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "post-transcriptional regulation of gene expression", "id": "GO:0010608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010608", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "translational initiation", "id": "GO:0006413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006413", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "positive regulation of macroautophagy", "id": "GO:0016239", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016239", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "TOR signaling", "id": "GO:0031929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031929", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "negative regulation of translational initiation", "id": "GO:0045947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045947", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "response to amino acid starvation", "id": "GO:1990928", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990928", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "TORC1 signaling", "id": "GO:0038202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038202", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "positive regulation of viral genome replication", "id": "GO:0045070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045070", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "positive regulation of translational initiation", "id": "GO:0045948", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045948", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" }, { "name": "cytoplasmic stress granule", "id": "GO:0010494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010494", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 382, "end_pos": 384, "annotation": "n_glycosylation_sequon" }, { "start_pos": 389, "end_pos": 391, "annotation": "n_glycosylation_sequon" }, { "start_pos": 664, "end_pos": 666, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on multiple Ser and Thr residues in response to active mTORC1. Phosphorylation is important for interaction with RPTOR and the mTORC1 complex. Phosphorylation promotes dissociation from the 5'UTR of mRNA molecules with a 5'TOP motif.", "evidence": [ { "database": "UniProtKB", "id": "Q6PKG0", "url": "https://www.uniprot.org/uniprot/Q6PKG0" }, { "database": "PubMed", "id": "28650797", "url": "https://glygen.org/publication/PubMed/28650797" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 61 }, { "field": "total_sites", "count": 58 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }