{
    "uniprot_canonical_ac": "Q6PHZ8-1",
    "uniprot_ac": "Q6PHZ8",
    "uniprot_id": "KCIP4_MOUSE",
    "mass": {
        "chemical_mass": 28756.0,
        "monoisotopic_mass": 28756.0
    },
    "refseq": {
        "ac": "NP_001186174",
        "name": "Kv channel-interacting protein 4 isoform 6",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
    },
    "gene_names": [
        {
            "name": "Kcnip4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8",
            "id": "Q6PHZ8"
        },
        {
            "name": "Calp; Calp250; KChIP4; KChIP4a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171",
            "id": "NP_001186171"
        },
        {
            "name": "Calp",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8",
            "id": "Q6PHZ8"
        },
        {
            "name": "Kchip4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8",
            "id": "Q6PHZ8"
        },
        {
            "name": "Kcnip4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171",
            "id": "NP_001186171"
        }
    ],
    "protein_names": [
        {
            "name": "Kv channel-interacting protein 4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q6PHZ8"
        },
        {
            "name": "A-type potassium channel modulatory protein 4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6PHZ8"
        },
        {
            "name": "Calsenilin-like protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6PHZ8"
        },
        {
            "name": "KChIP4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6PHZ8"
        },
        {
            "name": "Kv channel-interacting protein 4 isoform 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171",
            "id": "NP_001186171"
        },
        {
            "name": "Kv channel-interacting protein 4 isoform 5",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173",
            "id": "NP_001186173"
        },
        {
            "name": "Kv channel-interacting protein 4 isoform 6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174",
            "id": "NP_001186174"
        },
        {
            "name": "Potassium channel-interacting protein 4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6PHZ8"
        },
        {
            "name": "calsenilin-like protein; kv channel-interacting protein 4; potassium channel interacting protein 4; A-type potassium channel modulatory protein 4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173",
            "id": "NP_001186173"
        }
    ],
    "function": [
        {
            "annotation": "Genome-wide association study identifies KCNIP4 as an asthma gene in human and in mouse.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                },
                {
                    "database": "PubMed",
                    "id": "23457522",
                    "url": "https://glygen.org/publication/PubMed/23457522"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                }
            ]
        },
        {
            "annotation": "KChIP4 was highly expressed by neurons in layers II-IV of cortex and in hippocampus, thalamus and the Purkinje cell layer of the cerebellum.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                },
                {
                    "database": "PubMed",
                    "id": "15363885",
                    "url": "https://glygen.org/publication/PubMed/15363885"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                }
            ]
        },
        {
            "annotation": "KChIP4a functions to promote tetrameric assembly and enhance surface expression of Kv4 channels.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                },
                {
                    "database": "PubMed",
                    "id": "20550899",
                    "url": "https://glygen.org/publication/PubMed/20550899"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                }
            ]
        },
        {
            "annotation": "Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels, such as KCND2/Kv4.2 and KCND3/Kv4.3 (PubMed:19109250). Modulates channel expression at the cell membrane, gating characteristics, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8#function"
                },
                {
                    "database": "PubMed",
                    "id": "20045463",
                    "url": "https://glygen.org/publication/PubMed/20045463"
                },
                {
                    "database": "PubMed",
                    "id": "19109250",
                    "url": "https://glygen.org/publication/PubMed/19109250"
                },
                {
                    "database": "PubMed",
                    "id": "20943905",
                    "url": "https://glygen.org/publication/PubMed/20943905"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Kcnip4",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8",
            "locus": {
                "chromosome": "5",
                "start_pos": 48546844,
                "end_pos": 49682249,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000029088",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000029088"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000029088",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029088",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd00051",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "80334",
            "url": "https://www.ncbi.nlm.nih.gov/gene/80334",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR002048",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR011992",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018247",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR028846",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR028846",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:80334",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:80334",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1933131",
            "url": "http://www.informatics.jax.org/marker/MGI:1933131",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "GXDFIKG",
            "url": "https://omabrowser.org/oma/group/GXDFIKG/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "339700at2759",
            "url": "http://www.orthodb.org/?query=339700at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23055",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23055",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23055:SF30",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23055:SF30",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "3DD4",
            "url": "https://www.rcsb.org/structure/3DD4",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF13499",
            "url": "http://pfam.xfam.org/family/PF13499",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13833",
            "url": "http://pfam.xfam.org/family/PF13833",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q6PHZ8",
            "url": "http://purl.obolibrary.org/obo/PR_Q6PHZ8",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-5576894",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5576894",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001186171",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3UFC0",
            "url": "https://www.uniprot.org/uniprot/Q3UFC0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3UFC0-1",
            "url": "https://www.uniprot.org/uniprot/Q3UFC0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3YAA5",
            "url": "https://www.uniprot.org/uniprot/Q3YAA5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q3YAA5-1",
            "url": "https://www.uniprot.org/uniprot/Q3YAA5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6PHZ8",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6PHZ8-1",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6PHZ8-2",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6PHZ8-3",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8-3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6PHZ8-4",
            "url": "https://www.uniprot.org/uniprot/Q6PHZ8-4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
        "length": 250,
        "header": "sp|Q6PHZ8-1|KCIP4_MOUSE Isoform 1 of Kv channel-interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q3UFC0-1",
            "url": "",
            "sequence": {
                "sequence": "MSGCRKRCKREILKFAQYLLRLLTGSLHTDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 225,
                "header": "tr|Q3UFC0-1|Q3UFC0_MOUSE Computationally mapped isoform of Kv channel interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 49442682,
                "end_pos": 48548254,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000175660.5",
                        "url": "https://www.ensembl.org/id/ENSMUST00000175660.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000135799.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000135799.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q3YAA5-1",
            "url": "",
            "sequence": {
                "sequence": "MLTLEWESEGLQTVGIVVIICASLKLLHLLGLIDFSEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 233,
                "header": "tr|Q3YAA5-1|Q3YAA5_MOUSE Computationally mapped isoform of Potassium channel interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 48756876,
                "end_pos": 48548254,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000166924.8",
                        "url": "https://www.ensembl.org/id/ENSMUST00000166924.8"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000131276.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000131276.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q6PHZ8-1",
            "url": "",
            "sequence": {
                "sequence": "MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 250,
                "header": "sp|Q6PHZ8-1|KCIP4_MOUSE Isoform 1 of Kv channel-interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 49682043,
                "end_pos": 48548254,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000087395",
                        "url": "https://www.ensembl.org/id/ENSMUST00000087395"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000084656",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000084656"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q6PHZ8-2",
            "url": "",
            "sequence": {
                "sequence": "MNVRRVESISAQLEEASSTGDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 216,
                "header": "sp|Q6PHZ8-2|KCIP4_MOUSE Isoform 2 of Kv channel-interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 49682043,
                "end_pos": 48548254,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000176191",
                        "url": "https://www.ensembl.org/id/ENSMUST00000176191"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000135071",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000135071"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q6PHZ8-3",
            "url": "",
            "sequence": {
                "sequence": "MATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 188,
                "header": "sp|Q6PHZ8-3|KCIP4_MOUSE Isoform 3 of Kv channel-interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {}
        },
        {
            "isoform_ac": "Q6PHZ8-4",
            "url": "",
            "sequence": {
                "sequence": "MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 229,
                "header": "sp|Q6PHZ8-4|KCIP4_MOUSE Isoform 4 of Kv channel-interacting protein 4  OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1 CANONICAL=Q6PHZ8-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 49046807,
                "end_pos": 48548254,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000176978",
                        "url": "https://www.ensembl.org/id/ENSMUST00000176978"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000134758",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000134758"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 17,
            "end_pos": 17,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                },
                {
                    "database": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q6PHZ8",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PHZ8"
                }
            ],
            "site_lbl": "Ser17"
        },
        {
            "start_pos": 56,
            "end_pos": 56,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                },
                {
                    "database": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q6PHZ8",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PHZ8"
                }
            ],
            "site_lbl": "Ser56"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Elimination of fast inactivation in Kv4 A-type potassium channels by an auxiliary subunit domain.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2002",
            "authors": "Holmqvist MH, Cao J, Hernandez-Pineda R, Jacobson MD, Carroll KI, Sung MA, Betty M, Ge P, Gilbride KJ, Brown ME, Jurman ME, Lawson D, Silos-Santiago I, Xie Y, Covarrubias M, Rhodes KJ, Distefano PS, An WF",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11805342",
                    "url": "https://glygen.org/publication/PubMed/11805342"
                }
            ]
        },
        {
            "title": "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Morohashi Y, Hatano N, Ohya S, Takikawa R, Watabiki T, Takasugi N, Imaizumi Y, Tomita T, Iwatsubo T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11847232",
                    "url": "https://glygen.org/publication/PubMed/11847232"
                }
            ]
        },
        {
            "title": "Differential distribution of KChIPs mRNAs in adult mouse brain.",
            "journal": "Brain Res. Mol. Brain Res.",
            "date": "2004",
            "authors": "Xiong H, Kovacs I, Zhang Z",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15363885",
                    "url": "https://glygen.org/publication/PubMed/15363885"
                }
            ]
        },
        {
            "title": "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family.",
            "journal": "Genomics",
            "date": "2005",
            "authors": "Pruunsild P., Timmusk T.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q3YAA5",
                    "url": "https://www.uniprot.org/uniprot/Q3YAA5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16112838",
                    "url": "https://glygen.org/publication/PubMed/16112838"
                }
            ]
        },
        {
            "title": "Structural insights into KChIP4a modulation of Kv4.3 inactivation.",
            "journal": "J. Biol. Chem.",
            "date": "2009",
            "authors": "Liang P, Wang H, Chen H, Cui Y, Gu L, Chai J, Wang K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19109250",
                    "url": "https://glygen.org/publication/PubMed/19109250"
                }
            ]
        },
        {
            "title": "Proteomic analyses of native brain K(V)4.2 channel complexes.",
            "journal": "Channels",
            "date": "2009",
            "authors": "Marionneau C, LeDuc RD, Rohrs HW, Link AJ, Townsend RR, Nerbonne JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19713751",
                    "url": "https://glygen.org/publication/PubMed/19713751"
                }
            ]
        },
        {
            "title": "KChIP4a regulates Kv4.2 channel trafficking through PKA phosphorylation.",
            "journal": "Mol. Cell. Neurosci.",
            "date": "2010",
            "authors": "Lin L, Sun W, Wikenheiser AM, Kung F, Hoffman DA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20045463",
                    "url": "https://glygen.org/publication/PubMed/20045463"
                }
            ]
        },
        {
            "title": "Functional rescue of Kv4.3 channel tetramerization mutants by KChIP4a.",
            "journal": "Biophysical journal",
            "date": "2010",
            "authors": "Liang P, Chen H, Cui Y, Lei L, Wang K",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20550899",
                    "url": "https://glygen.org/publication/PubMed/20550899"
                }
            ]
        },
        {
            "title": "Interdependent roles for accessory KChIP2, KChIP3, and KChIP4 subunits in the generation of Kv4-encoded IA channels in cortical pyramidal neurons.",
            "journal": "J. Neurosci.",
            "date": "2010",
            "authors": "Norris AJ, Foeger NC, Nerbonne JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20943905",
                    "url": "https://glygen.org/publication/PubMed/20943905"
                }
            ]
        },
        {
            "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.",
            "journal": "Cell",
            "date": "2010",
            "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6PHZ8",
                    "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q6PHZ8",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PHZ8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21183079",
                    "url": "https://glygen.org/publication/PubMed/21183079"
                }
            ]
        },
        {
            "title": "Integration of mouse and human genome-wide association data identifies KCNIP4 as an asthma gene.",
            "journal": "PloS one",
            "date": "2013",
            "authors": "Himes BE, Sheppard K, Berndt A, Leme AS, Myers RA, Gignoux CR, Levin AM, Gauderman WJ, Yang JJ, Mathias RA, Romieu I, Torgerson DG, Roth LA, Huntsman S, Eng C, Klanderman B, Ziniti J, Senter-Sylvia J, Szefler SJ, Lemanske RF Jr, Zeiger RS, Strunk RC, Martinez FD, Boushey H, Chinchilli VM, Israel E, Mauger D, Koppelman GH, Postma DS, Nieuwenhuis MA, Vonk JM, Lima JJ, Irvin CG, Peters SP, Kubo M, Tamari M, Nakamura Y, Litonjua AA, Tantisira KG, Raby BA, Bleecker ER, Meyers DA, London SJ, Barnes KC, Gilliland FD, Williams LK, Burchard EG, Nicolae DL, Ober C, DeMeo DL, Silverman EK, Paigen B, Churchill G, Shapiro SD, Weiss ST",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001186173",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186173"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186171",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186171"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001186174",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001186174"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23457522",
                    "url": "https://glygen.org/publication/PubMed/23457522"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:80334",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:80334",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-5576894",
            "name": "Phase 1 - inactivation of fast Na+ channels",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5576894",
            "resource": "Reactome",
            "description": "Phase 1 - inactivation of fast Na+ channels"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q6PIL6-1",
            "protein_name": "Kv channel-interacting protein 4",
            "gene_name": "KCNIP4",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 250
            },
            "evidence": [
                {
                    "id": "45236143",
                    "url": "http://www.informatics.jax.org/homology/45236143",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q99MG9-1",
            "protein_name": "Kv channel-interacting protein 4",
            "gene_name": "Kcnip4",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI",
                "length": 250
            },
            "evidence": [
                {
                    "id": "45236143",
                    "url": "http://www.informatics.jax.org/homology/45236143",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "regulation of potassium ion transmembrane transport",
                        "id": "GO:1901379",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901379",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein localization to plasma membrane",
                        "id": "GO:0072659",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072659",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 7,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisome",
                        "id": "GO:0005777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "dendrite",
                        "id": "GO:0030425",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "neuronal cell body",
                        "id": "GO:0043025",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "voltage-gated potassium channel complex",
                        "id": "GO:0008076",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008076",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "potassium channel regulator activity",
                        "id": "GO:0015459",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015459",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "calcium ion binding",
                        "id": "GO:0005509",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "potassium channel activity",
                        "id": "GO:0005267",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005267",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "voltage-gated monoatomic ion channel activity",
                        "id": "GO:0005244",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005244",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6PHZ8",
                                "url": "https://www.uniprot.org/uniprot/Q6PHZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 27,
            "end_pos": 29,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 11
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}