{ "uniprot_canonical_ac": "Q6PEM8-1", "uniprot_ac": "Q6PEM8", "uniprot_id": "PCFT_MOUSE", "mass": { "chemical_mass": 50089.0, "monoisotopic_mass": 50089.0 }, "refseq": { "ac": "NP_081016", "name": "proton-coupled folate transporter", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, "gene_names": [ { "name": "Slc46a1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "id": "Q6PEM8" }, { "name": "1110002C08Rik; D11Ertd18e; HCP1; Pcft", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016", "id": "NP_081016" }, { "name": "D11Ertd18e", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "id": "Q6PEM8" }, { "name": "Hcp1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "id": "Q6PEM8" }, { "name": "Pcft", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "id": "Q6PEM8" }, { "name": "Slc46a1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016", "id": "NP_081016" } ], "protein_names": [ { "name": "Proton-coupled folate transporter", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6PEM8" }, { "name": "Heme carrier protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6PEM8" }, { "name": "PCFT/HCP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6PEM8" }, { "name": "Solute carrier family 46 member 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6PEM8" }, { "name": "heme carrier protein 1; PCFT/HCP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016", "id": "NP_081016" }, { "name": "proton-coupled folate transporter", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016", "id": "NP_081016" } ], "function": [ { "annotation": "Functional regulation of P-glycoprotein at the blood-brain barrier in proton-coupled folate transporter (PCFT) mutant mice.", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, { "database": "PubMed", "id": "23212123", "url": "https://glygen.org/publication/PubMed/23212123" } ] }, { "annotation": "Heme carrier protein 1(HCP 1)is the long-sought intestinal heme transporter and was iron regulated and localized to the brush-border membrane of duodenal enterocytes in iron deficiency. Its mRNA was expressed in duodenum and regulated by hypoxia", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, { "database": "PubMed", "id": "16143108", "url": "https://glygen.org/publication/PubMed/16143108" } ] }, { "annotation": "Loss of SLC46A1 decreases tumor iron content in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, { "database": "PubMed", "id": "35811443", "url": "https://glygen.org/publication/PubMed/35811443" } ] }, { "annotation": "Proton-coupled folate symporter that mediates folate absorption using an H(+) gradient as a driving force (PubMed:17962486). Involved in the intestinal absorption of folates at the brush-border membrane of the proximal jejunum, and the transport from blood to cerebrospinal fluid across the choroid plexus (PubMed:17962486). Functions at acidic pH via alternate outward- and inward-open conformation states (By similarity). Protonation of residues in the outward open state primes the protein for transport (By similarity). Binding of folate promotes breaking of salt bridge network and subsequent closure of the extracellular gate, leading to the inward-open state and release of protons and folate (By similarity). Also able to transport antifolate drugs, such as methotrexate and pemetrexed (PubMed:17962486). Involved in FOLR1-mediated endocytosis by serving as a route of export of folates from acidified endosomes (By similarity). Also acts as a lower-affinity, pH-independent heme carrier protein and constitutes the main importer of heme in the intestine (PubMed:16143108). Imports heme in the retina and retinal pigment epithelium, in neurons of the hippocampus, in hepatocytes and in the renal epithelial cells (PubMed:22058337). Hence, participates in the trafficking of heme and increases intracellular iron content (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8#function" }, { "database": "PubMed", "id": "16143108", "url": "https://glygen.org/publication/PubMed/16143108" }, { "database": "UniProtKB", "id": "Q96NT5", "url": "https://www.uniprot.org/uniprot/Q96NT5#function" }, { "database": "PubMed", "id": "22058337", "url": "https://glygen.org/publication/PubMed/22058337" }, { "database": "PubMed", "id": "17962486", "url": "https://glygen.org/publication/PubMed/17962486" } ] }, { "annotation": "SLC46A1 contributes to hepatic iron metabolism by importing heme in hepatocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, { "database": "PubMed", "id": "32621820", "url": "https://glygen.org/publication/PubMed/32621820" } ] }, { "annotation": "Slc46a1/PCFT plays critical role in intestinal folate absorption.", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" }, { "database": "PubMed", "id": "17898134", "url": "https://glygen.org/publication/PubMed/17898134" } ] } ], "disease": [ { "disease_id": "DOID:0111678", "recommended_name": { "id": "DOID:0111678", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111678", "name": "hereditary folate malabsorption", "description": "A vitamin metabolic disorder characterized by impaired intestinal folate absorption and impaired transport of folate into the central nervous system resulting in megaloblastic anemia, diarrhea, immune deficiency, infections, and neurologic deficits that has_material_basis_in homozygous or compound heterozygous mutation in the SLC46A1 gene on chromosome 17q11.2." }, "synonyms": [ { "id": "DOID:0111678", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111678", "name": "congenital defect of folate absorption", "description": "" }, { "id": "DOID:0111678", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111678", "name": "congenital folate malabsorption", "description": "" }, { "id": "MONDO:0009238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009238", "name": "hereditary folate malabsorption", "description": "Hereditary folate malabsorption (HFM) is an inherited disorder of folate transport characterized by a systemic and central nervous system (CNS) folate deficiency manifesting as megaloblastic anemia, failure to thrive, diarrhea and/or oral mucositis, immunologic dysfunction and neurological disorders." }, { "id": "MONDO:0009238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009238", "name": "congenital folate malabsorption", "description": "" }, { "id": "MONDO:0009238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009238", "name": "congenital defect of folate absorption", "description": "" }, { "id": "MONDO:0009238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009238", "name": "folate malabsorption, hereditary", "description": "" }, { "id": "MONDO:0009238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009238", "name": "folic acid transport defect", "description": "" }, { "id": "MIM:229050", "resource": "MIM", "url": "https://www.omim.org/entry/229050", "name": "Hereditary folate malabsorption", "description": "Hereditary folate malabsorption" } ], "evidence": [ { "id": "0111678", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111678" } ] }, { "disease_id": "DOID:784", "recommended_name": { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney disease", "description": "A kidney failure that is characterized by the gradual loss of kidney function." }, "synonyms": [ { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CKD", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CRF", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney failure", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal disease", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal failure syndrome", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "renal failure - chronic", "description": "" } ], "evidence": [ { "id": "784", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:784" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc46a1", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "locus": { "chromosome": "11", "start_pos": 78362885, "end_pos": 78356523, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020829", "url": "https://www.ensembl.org/id/ENSMUSG00000020829" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020829", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020829", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "52466", "url": "https://www.ncbi.nlm.nih.gov/gene/52466", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0002662", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002662", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0005828", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0005828", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR005829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011701", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011701", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:52466", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:52466", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1098733", "url": "http://www.informatics.jax.org/marker/MGI:1098733", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WHLYSSG", "url": "https://omabrowser.org/oma/group/WHLYSSG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2880402at2759", "url": "http://www.orthodb.org/?query=2880402at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23507", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23507", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23507:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23507:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07690", "url": "http://pfam.xfam.org/family/PF07690", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6PEM8", "url": "http://purl.obolibrary.org/obo/PR_Q6PEM8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-196757", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196757", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917937", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9707616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "70159", "url": "https://www.rhea-db.org/rhea/70159", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70163", "url": "https://www.rhea-db.org/rhea/70163", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70167", "url": "https://www.rhea-db.org/rhea/70167", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70171", "url": "https://www.rhea-db.org/rhea/70171", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F6QD87", "url": "https://www.uniprot.org/uniprot/F6QD87", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QD87-1", "url": "https://www.uniprot.org/uniprot/F6QD87-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PEM8-1", "url": "https://www.uniprot.org/uniprot/Q6PEM8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEGRVSSVGSPHSFLNAPVLFRGPVEPLVFLANFALVLQGPLTTQYLWHRFSTELGYNGTRHRENCGNQSADPLMKEVETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVMALYAAFCFGETVKEPKSTRLFTLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSAPLCWDSKLIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLLGAGLLFIPAILIGVLEKVNPHPEFQQFPQSP", "length": 459, "header": "sp|Q6PEM8-1|PCFT_MOUSE Isoform 1 of Proton-coupled folate transporter OS=Mus musculus OX=10090 GN=Slc46a1 PE=1 SV=1 CANONICAL=Q6PEM8-1" }, "isoforms": [ { "isoform_ac": "F6QD87-1", "url": "", "sequence": { "sequence": "MEGRVSSVGSPHSFLNAPVLFRGPVEPLVFLANFALVLQGPLTTQYLWHRFSTELGYNGTRHRENCGNQSADPLMKGTDCSSCHWSRRLSSGPSFPSW", "length": 98, "header": "tr|F6QD87-1|F6QD87_MOUSE Computationally mapped isoform of Solute carrier family 46, member 1 OS=Mus musculus OX=10090 GN=Slc46a1 PE=1 SV=2 CANONICAL=Q6PEM8-1" }, "locus": { "chromosome": "11", "start_pos": 78359516, "end_pos": 78356604, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000146431.3", "url": "https://www.ensembl.org/id/ENSMUST00000146431.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119800.3", "url": "https://www.ensembl.org/id/ENSMUSP00000119800.3" } ] } }, { "isoform_ac": "Q6PEM8-1", "url": "", "sequence": { "sequence": "MEGRVSSVGSPHSFLNAPVLFRGPVEPLVFLANFALVLQGPLTTQYLWHRFSTELGYNGTRHRENCGNQSADPLMKEVETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVMALYAAFCFGETVKEPKSTRLFTLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSAPLCWDSKLIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLLGAGLLFIPAILIGVLEKVNPHPEFQQFPQSP", "length": 459, "header": "sp|Q6PEM8-1|PCFT_MOUSE Isoform 1 of Proton-coupled folate transporter OS=Mus musculus OX=10090 GN=Slc46a1 PE=1 SV=1 CANONICAL=Q6PEM8-1" }, "locus": { "chromosome": "11", "start_pos": 78362251, "end_pos": 78356604, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000001126", "url": "https://www.ensembl.org/id/ENSMUST00000001126" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000001126", "url": "https://www.ensembl.org/id/ENSMUSP00000001126" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "Q6PEM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PEM8#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 68, "start_aa": "Asn", "end_pos": 68, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn68", "evidence": [ { "id": "Q6PEM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PEM8#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q6PEM8", "url": "http://phospho.elm.eu.org/byAccession/Q6PEM8.html" }, { "database": "iPTMnet", "id": "Q6PEM8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PEM8" } ], "site_lbl": "Ser458" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "site_lbl": "Ser6" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of an intestinal heme transporter.", "journal": "Cell", "date": "2005", "authors": "Shayeghi M, Latunde-Dada GO, Oakhill JS, Laftah AH, Takeuchi K, Halliday N, Khan Y, Warley A, McCann FE, Hider RC, Frazer DM, Anderson GJ, Vulpe CD, Simpson RJ, McKie AT", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" }, { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" } ], "reference": [ { "type": "PubMed", "id": "16143108", "url": "https://glygen.org/publication/PubMed/16143108" } ] }, { "title": "Rodent intestinal folate transporters (SLC46A1): secondary structure, functional properties, and response to dietary folate restriction.", "journal": "American journal of physiology. Cell physiology", "date": "2007", "authors": "Qiu A, Min SH, Jansen M, Malhotra U, Tsai E, Cabelof DC, Matherly LH, Zhao R, Akabas MH, Goldman ID", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" } ], "reference": [ { "type": "PubMed", "id": "17898134", "url": "https://glygen.org/publication/PubMed/17898134" } ] }, { "title": "Cloning and functional characterization of the proton-coupled electrogenic folate transporter and analysis of its expression in retinal cell types.", "journal": "Invest. Ophthalmol. Vis. Sci.", "date": "2007", "authors": "Umapathy NS, Gnana-Prakasam JP, Martin PM, Mysona B, Dun Y, Smith SB, Ganapathy V, Prasad PD", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "17962486", "url": "https://glygen.org/publication/PubMed/17962486" } ] }, { "title": "A role for the proton-coupled folate transporter (PCFT-SLC46A1) in folate receptor-mediated endocytosis.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Wang Y., Low P.S., Zhao R., Min S.H., Goldman I.D., Campanella E.", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "19074442", "url": "https://glygen.org/publication/PubMed/19074442" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" }, { "database": "iPTMnet", "id": "Q6PEM8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8#ptm_processing" }, { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "A mouse model of hereditary folate malabsorption: deletion of the PCFT gene leads to systemic folate deficiency.", "journal": "Blood", "date": "2011", "authors": "Lin C., Sun W., Liu Q., Duncan L., Finnell R.H., Oravecz T., Vogel P., Chang W.C., Platt K.A., Read R., Cabrera R.M., Salojin K.V.", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "21346251", "url": "https://glygen.org/publication/PubMed/21346251" } ] }, { "title": "Polarized distribution of heme transporters in retinal pigment epithelium and their regulation in the iron-overload disease hemochromatosis.", "journal": "Invest. Ophthalmol. Vis. Sci.", "date": "2011", "authors": "Gnana-Prakasam JP, Reddy SK, Veeranan-Karmegam R, Smith SB, Martin PM, Ganapathy V", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "reference": [ { "type": "PubMed", "id": "22058337", "url": "https://glygen.org/publication/PubMed/22058337" } ] }, { "title": "Functional regulation of P-glycoprotein at the blood-brain barrier in proton-coupled folate transporter (PCFT) mutant mice.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2013", "authors": "Wang X, Cabrera RM, Li Y, Miller DS, Finnell RH", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" } ], "reference": [ { "type": "PubMed", "id": "23212123", "url": "https://glygen.org/publication/PubMed/23212123" } ] }, { "title": "SLC46A1 contributes to hepatic iron metabolism by importing heme in hepatocytes.", "journal": "Metabolism: clinical and experimental", "date": "2020", "authors": "Li H, Wang D, Wu H, Shen H, Lv D, Zhang Y, Lu H, Yang J, Tang Y, Li M", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" } ], "reference": [ { "type": "PubMed", "id": "32621820", "url": "https://glygen.org/publication/PubMed/32621820" } ] }, { "title": "Loss of SLC46A1 decreases tumor iron content in hepatocellular carcinoma.", "journal": "Hepatology communications", "date": "2022", "authors": "Wang D, Wu H, Yang J, Li M, Ling C, Gao Z, Lu H, Shen H, Tang Y", "evidence": [ { "database": "RefSeq", "id": "NP_081016", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081016" } ], "reference": [ { "type": "PubMed", "id": "35811443", "url": "https://glygen.org/publication/PubMed/35811443" } ] } ], "pathway": [ { "id": "mmu:52466", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:52466", "resource": "KEGG Pathway" }, { "id": "R-MMU-196757", "name": "Metabolism of folate and pterines", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196757", "resource": "Reactome", "description": "Metabolism of folate and pterines" }, { "id": "R-MMU-917937", "name": "Iron uptake and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917937", "resource": "Reactome", "description": "Iron uptake and transport" }, { "id": "R-MMU-9707616", "name": "Heme signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9707616", "resource": "Reactome", "description": "Heme signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5EBA8-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "Slc46a1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEGRVSPVGSSHRLLTAAVLFRGPVEPLVFLANFALVLQGPLTTQYIWHRISTELGYNGTRHRENCGNQSADPVLKEVETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLQLHIGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALAVLIVMTLYAAFCFGETVKEPKSTRLFTLRHHRSIVQLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSLYPATLNFMKGFPFLLGAGLLFIPAILIGVLEKVNPHPEFQQFPQNS", "length": 459 }, "evidence": [ { "id": "45232032", "url": "http://www.informatics.jax.org/homology/45232032", "database": "MGI" }, { "id": "Q6PEM8", "url": "https://omabrowser.org/oma/group/Q6PEM8/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP", "length": 459 }, "evidence": [ { "id": "45232032", "url": "http://www.informatics.jax.org/homology/45232032", "database": "MGI" }, { "id": "Q6PEM8", "url": "https://omabrowser.org/oma/group/Q6PEM8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "methotrexate transmembrane transporter activity", "id": "GO:0015350", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015350", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "heme transmembrane transporter activity", "id": "GO:0015232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015232", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "symporter activity", "id": "GO:0015293", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015293", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "proton transmembrane transporter activity", "id": "GO:0015078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015078", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folic acid binding", "id": "GO:0005542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005542", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folic acid transmembrane transporter activity", "id": "GO:0008517", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008517", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folic acid:proton symporter activity", "id": "GO:0140211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140211", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "brush border membrane", "id": "GO:0031526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031526", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "heme transport", "id": "GO:0015886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015886", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folic acid transport", "id": "GO:0015884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015884", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folate transmembrane transport", "id": "GO:0098838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098838", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "proton transmembrane transport", "id": "GO:1902600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902600", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" }, { "name": "folate import across plasma membrane", "id": "GO:1904447", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904447", "evidence": [ { "database": "UniProtKB", "id": "Q6PEM8", "url": "https://www.uniprot.org/uniprot/Q6PEM8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 174, "end_pos": 176, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" }, { "start_pos": 68, "end_pos": 70, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "70159", "name": "", "equation": "folate(in) + H(+)(in) = folate(out) + H(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70159", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70159" } ] }, { "id": "70163", "name": "", "equation": "H(+)(in) + methotrexate(in) = H(+)(out) + methotrexate(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70163", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70163" } ] }, { "id": "70167", "name": "", "equation": "(6S)-5-methyl-5,6,7,8-tetrahydrofolate(in) + H(+)(in) = (6S)-5-methyl-5,6,7,8-tetrahydrofolate(out) + H(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70167", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70167" } ] }, { "id": "70171", "name": "", "equation": "H(+)(in) + pemetrexed(in) = H(+)(out) + pemetrexed(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "70171", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70171" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }