{ "uniprot_canonical_ac": "Q6PD29-1", "uniprot_ac": "Q6PD29", "uniprot_id": "ZN513_MOUSE", "mass": { "chemical_mass": 58067.0, "monoisotopic_mass": 58067.0 }, "refseq": { "ac": "NP_001171372", "name": "zinc finger protein 513 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372" }, "gene_names": [ { "name": "Zfp513", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6PD29", "id": "Q6PD29" }, { "name": "Znf513", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6PD29", "id": "Q6PD29" }, { "name": "D430028M17Rik; Znf513", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372", "id": "NP_001171372" }, { "name": "Zfp513", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372", "id": "NP_001171372" }, { "name": "Zfp513", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6PD29", "id": "Q6PD29" } ], "protein_names": [ { "name": "Zinc finger protein 513", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6PD29" }, { "name": "zinc finger protein 513 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372", "id": "NP_001171372" } ], "function": [ { "annotation": "These results suggest that the ZNF513 p.C339R mutation is responsible for retinitis pigmentosa and that ZNF513 plays a key role in the regulation of photoreceptor-specific genes in retinal development and photoreceptor maintenance.", "evidence": [ { "database": "RefSeq", "id": "NP_001171372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372" }, { "database": "PubMed", "id": "20797688", "url": "https://glygen.org/publication/PubMed/20797688" } ] }, { "annotation": "Transcriptional regulator that plays a role in retinal development and maintenance.", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29#function" } ] } ], "disease": [ { "disease_id": "DOID:0110362", "recommended_name": { "id": "DOID:0110362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110362", "name": "retinitis pigmentosa 58", "description": "A retinitis pigmentosa that has_material_basis_in mutation in the ZNF513 gene on chromosome 2p23." }, "synonyms": [ { "id": "DOID:0110362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110362", "name": "RP58", "description": "" }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "retinitis pigmentosa 58", "description": "Any retinitis pigmentosa in which the cause of the disease is a mutation in the ZNF513 gene." }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "RP58", "description": "" }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "ZNF513 retinitis pigmentosa", "description": "" }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "retinitis pigmentosa 58", "description": "" }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "retinitis pigmentosa caused by mutation in ZNF513", "description": "" }, { "id": "MONDO:0013328", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013328", "name": "retinitis pigmentosa type 58", "description": "" }, { "id": "MIM:613617", "resource": "MIM", "url": "https://www.omim.org/entry/613617", "name": "Retinitis pigmentosa 58", "description": "Retinitis pigmentosa 58" } ], "evidence": [ { "id": "0110362", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110362" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Znf513", "url": "https://www.uniprot.org/uniprot/Q6PD29", "locus": {} } ], "crossref": [ { "id": "ENSMUSG00000043059", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000043059", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "101023", "url": "https://www.ncbi.nlm.nih.gov/gene/101023", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6PD29", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6PD29*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:101023", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:101023", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2141255", "url": "http://www.informatics.jax.org/marker/MGI:2141255", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SICGYSC", "url": "https://omabrowser.org/oma/group/SICGYSC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5353596at2759", "url": "http://www.orthodb.org/?query=5353596at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399:SF23", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399:SF23", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6PD29", "url": "http://purl.obolibrary.org/obo/PR_Q6PD29", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001171372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0J9YTR6", "url": "https://www.uniprot.org/uniprot/A0A0J9YTR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YTR6-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YTR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YUG7", "url": "https://www.uniprot.org/uniprot/A0A0J9YUG7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YUG7-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YUG7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BL06", "url": "https://www.uniprot.org/uniprot/H3BL06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BL06-1", "url": "https://www.uniprot.org/uniprot/H3BL06-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PD29-1", "url": "https://www.uniprot.org/uniprot/Q6PD29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6PD29-2", "url": "https://www.uniprot.org/uniprot/Q6PD29-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRRKQSHPQPVKCEGVKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDSP", "length": 541, "header": "sp|Q6PD29-1|ZN513_MOUSE Isoform 1 of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2 CANONICAL=Q6PD29-1" }, "isoforms": [ { "isoform_ac": "A0A0J9YTR6-1", "url": "", "sequence": { "sequence": "MPRRKQSHPQPVKCEGVKGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQ", "length": 69, "header": "tr|A0A0J9YTR6-1|ZN513_MOUSE Computationally mapped isoform of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=3 CANONICAL=Q6PD29-1" }, "locus": { "chromosome": "5", "start_pos": 31359385, "end_pos": 31358015, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000202929.2", "url": "https://www.ensembl.org/id/ENSMUST00000202929.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143817.2", "url": "https://www.ensembl.org/id/ENSMUSP00000143817.2" } ] } }, { "isoform_ac": "A0A0J9YUG7-1", "url": "", "sequence": { "sequence": "MGTAWEGDSTSTLPSLVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGG", "length": 90, "header": "tr|A0A0J9YUG7-1|A0A0J9YUG7_MOUSE Computationally mapped isoform of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Zfp513 PE=1 SV=3 CANONICAL=Q6PD29-1" }, "locus": { "chromosome": "5", "start_pos": 31359131, "end_pos": 31358102, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000201231.2", "url": "https://www.ensembl.org/id/ENSMUST00000201231.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000144172.2", "url": "https://www.ensembl.org/id/ENSMUSP00000144172.2" } ] } }, { "isoform_ac": "H3BL06-1", "url": "", "sequence": { "sequence": "RPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELLFPWTCRGCGQELEEVYAPLPLTTPTTWLGT", "length": 92, "header": "tr|H3BL06-1|H3BL06_MOUSE Computationally mapped isoform of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Zfp513 PE=4 SV=1 CANONICAL=Q6PD29-1" }, "locus": { "chromosome": "5", "start_pos": 31357630, "end_pos": 31357156, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000201968.2", "url": "https://www.ensembl.org/id/ENSMUST00000201968.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000144517.2", "url": "https://www.ensembl.org/id/ENSMUSP00000144517.2" } ] } }, { "isoform_ac": "Q6PD29-1", "url": "", "sequence": { "sequence": "MPRRKQSHPQPVKCEGVKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDSP", "length": 541, "header": "sp|Q6PD29-1|ZN513_MOUSE Isoform 1 of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2 CANONICAL=Q6PD29-1" }, "locus": { "chromosome": "5", "start_pos": 31359385, "end_pos": 31356668, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000114590", "url": "https://www.ensembl.org/id/ENSMUST00000114590" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000110238", "url": "https://www.ensembl.org/id/ENSMUSP00000110238" } ] } }, { "isoform_ac": "Q6PD29-2", "url": "", "sequence": { "sequence": "MGTAWEGDSTSTLPSLVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDSP", "length": 539, "header": "sp|Q6PD29-2|ZN513_MOUSE Isoform 2 of Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2 CANONICAL=Q6PD29-1" }, "locus": { "chromosome": "5", "start_pos": 31359131, "end_pos": 31356668, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000031562", "url": "https://www.ensembl.org/id/ENSMUST00000031562" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000031562", "url": "https://www.ensembl.org/id/ENSMUSP00000031562" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "site_lbl": "Ser85" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q6PD29", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PD29" } ], "site_lbl": "Ser96" } ], "glycation": [], "keywords": [], "publication": [ { "title": "A mutation in ZNF513, a putative regulator of photoreceptor development, causes autosomal-recessive retinitis pigmentosa.", "journal": "Am. J. Hum. Genet.", "date": "2010", "authors": "Li L, Nakaya N, Chavali VR, Ma Z, Jiao X, Sieving PA, Riazuddin S, Tomarev SI, Ayyagari R, Riazuddin SA, Hejtmancik JF", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" }, { "database": "RefSeq", "id": "NP_001171372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171372" } ], "reference": [ { "type": "PubMed", "id": "20797688", "url": "https://glygen.org/publication/PubMed/20797688" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" }, { "database": "iPTMnet", "id": "Q6PD29", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PD29" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] } ], "pathway": [ { "id": "mmu:101023", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:101023", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5FWU5-1", "protein_name": "Zinc finger protein 513", "gene_name": "Znf513", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPRRKQSHPQPVKCEGVKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEEEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGTSFLPDCGQLRGEGEGLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGTAMCGRCMRGESGGGGSGGPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGSAALGATGSRALHTDSP", "length": 541 }, "evidence": [ { "id": "45227876", "url": "http://www.informatics.jax.org/homology/45227876", "database": "MGI" }, { "id": "Q6PD29", "url": "https://omabrowser.org/oma/group/Q6PD29/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8N8E2-1", "protein_name": "Zinc finger protein 513", "gene_name": "ZNF513", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPRRKQSHPQPVKCEGVKVDTEDSLDEGPGALVLESDLLLGQDLEFEEEEEEEEGDGNSDQLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPLLPPRLLYSCRLCTFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHAGPPTPPCPTCGFRCCTPRPARPPSPTEQEGAVPRRPEDALLLPDLSLHVPPGGASFLPDCGQLRGEGEGLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSASEGWAPPHSPPSVLSSRGPPALGTAGSRAVHTDSS", "length": 541 }, "evidence": [ { "id": "45227876", "url": "http://www.informatics.jax.org/homology/45227876", "database": "MGI" }, { "id": "Q6PD29", "url": "https://omabrowser.org/oma/group/Q6PD29/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" }, { "name": "retina development in camera-type eye", "id": "GO:0060041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060041", "evidence": [ { "database": "UniProtKB", "id": "Q6PD29", "url": "https://www.uniprot.org/uniprot/Q6PD29" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 450, "end_pos": 452, "annotation": "n_glycosylation_sequon" }, { "start_pos": 454, "end_pos": 456, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }