{ "uniprot_canonical_ac": "Q6P8J7-1", "uniprot_ac": "Q6P8J7", "uniprot_id": "KCRS_MOUSE", "mass": { "chemical_mass": 47473.0, "monoisotopic_mass": 47473.0 }, "refseq": { "ac": "NP_940807", "name": "creatine kinase S-type, mitochondrial precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807" }, "gene_names": [ { "name": "Ckmt2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6P8J7", "id": "Q6P8J7" }, { "name": "2300008A19Rik; mib-CK; S-MtCK; ScCKmit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807", "id": "NP_940807" }, { "name": "Ckmt2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807", "id": "NP_940807" } ], "protein_names": [ { "name": "Creatine kinase S-type, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6P8J7" }, { "name": "2.7.3.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P8J7" }, { "name": "Basic-type mitochondrial creatine kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P8J7" }, { "name": "Mib-CK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P8J7" }, { "name": "S-MtCK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P8J7" }, { "name": "Sarcomeric mitochondrial creatine kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P8J7" }, { "name": "creatine kinase S-type, mitochondrial precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807", "id": "NP_940807" }, { "name": "creatine kinase S-type, mitochondrial; basic-type mitochondrial creatine kinase; sarcomeric mitochondrial creatine kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807", "id": "NP_940807" } ], "function": [ { "annotation": "Modest elevation of MtCK activity in the heart does not adversely affect cellular metabolism, mitochondrial or in vivo cardiac function, but modifies mPTP opening to protect against I/R injury and improve functional recovery.", "evidence": [ { "database": "RefSeq", "id": "NP_940807", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807" }, { "database": "PubMed", "id": "29509881", "url": "https://glygen.org/publication/PubMed/29509881" } ] }, { "annotation": "Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ckmt2", "url": "https://www.uniprot.org/uniprot/Q6P8J7", "locus": { "chromosome": "13", "start_pos": 92001506, "end_pos": 92025004, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000021622", "url": "https://www.ensembl.org/id/ENSMUSG00000021622" } ] } } ], "crossref": [ { "id": "ENSMUSG00000021622", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000021622", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00716", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00716", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "76722", "url": "https://www.ncbi.nlm.nih.gov/gene/76722", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6P8J7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6P8J7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000749", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000749", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014746", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014746", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022414", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022414", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022415", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022415", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036802", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036802", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:76722", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76722", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1923972", "url": "http://www.informatics.jax.org/marker/MGI:1923972", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q6P8J7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6P8J7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HMRVIAM", "url": "https://omabrowser.org/oma/group/HMRVIAM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "35839at2759", "url": "http://www.orthodb.org/?query=35839at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11547", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11547", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11547:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11547:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00217", "url": "http://pfam.xfam.org/family/PF00217", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02807", "url": "http://pfam.xfam.org/family/PF02807", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6P8J7", "url": "http://purl.obolibrary.org/obo/PR_Q6P8J7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-71288", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71288", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_940807", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17157", "url": "https://www.rhea-db.org/rhea/17157", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P8J7-1", "url": "https://www.uniprot.org/uniprot/Q6P8J7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASAFSKLLTGRNASLLFTTLGTSALTTGYLLNRQKVSADAREQHKLFPPSADYPDLRKHNNCMAECLTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHPTDLDASKITHGQFDERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGRK", "length": 419, "header": "sp|Q6P8J7-1|KCRS_MOUSE Isoform 1 of Creatine kinase S-type, mitochondrial OS=Mus musculus OX=10090 GN=Ckmt2 PE=1 SV=1 CANONICAL=Q6P8J7-1" }, "isoforms": [ { "isoform_ac": "Q6P8J7-1", "url": "", "sequence": { "sequence": "MASAFSKLLTGRNASLLFTTLGTSALTTGYLLNRQKVSADAREQHKLFPPSADYPDLRKHNNCMAECLTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHPTDLDASKITHGQFDERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGRK", "length": 419, "header": "sp|Q6P8J7-1|KCRS_MOUSE Isoform 1 of Creatine kinase S-type, mitochondrial OS=Mus musculus OX=10090 GN=Ckmt2 PE=1 SV=1 CANONICAL=Q6P8J7-1" }, "locus": { "chromosome": "13", "start_pos": 92013452, "end_pos": 92001651, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000022122", "url": "https://www.ensembl.org/id/ENSMUST00000022122" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000022122", "url": "https://www.ensembl.org/id/ENSMUSP00000022122" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q6P8J7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6P8J7" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [ { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "site_lbl": "Tyr255" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q6P8J7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6P8J7" } ], "site_lbl": "Thr356" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" }, { "database": "iPTMnet", "id": "Q6P8J7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6P8J7" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Over-expression of mitochondrial creatine kinase in the murine heart improves functional recovery and protects against injury following ischaemia-reperfusion.", "journal": "Cardiovascular research", "date": "2018", "authors": "Whittington HJ, Ostrowski PJ, McAndrew DJ, Cao F, Shaw A, Eykyn TR, Lake HA, Tyler J, Schneider JE, Neubauer S, Zervou S, Lygate CA", "evidence": [ { "database": "RefSeq", "id": "NP_940807", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_940807" } ], "reference": [ { "type": "PubMed", "id": "29509881", "url": "https://glygen.org/publication/PubMed/29509881" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6P8J7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6P8J7" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q6P8J7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6P8J7" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:76722", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76722", "resource": "KEGG Pathway" }, { "id": "R-MMU-71288", "name": "Creatine metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71288", "resource": "Reactome", "description": "Creatine metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P09605-1", "protein_name": "Creatine kinase S-type, mitochondrial", "gene_name": "Ckmt2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASAFSKLLTGRNASLLFTTLGTSALTTGYLLNRQKVSADAREQHKLFPPSADYPDLRKHNNCMAECLTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRLMKHPADLDASKITHGQFDERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVAITALGGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGRK", "length": 419 }, "evidence": [ { "id": "45236353", "url": "http://www.informatics.jax.org/homology/45236353", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P17540-1", "protein_name": "Creatine kinase S-type, mitochondrial", "gene_name": "CKMT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK", "length": 419 }, "evidence": [ { "id": "45236353", "url": "http://www.informatics.jax.org/homology/45236353", "database": "MGI" }, { "id": "Q6P8J7", "url": "https://omabrowser.org/oma/group/Q6P8J7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "phosphocreatine biosynthetic process", "id": "GO:0046314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046314", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" }, { "name": "phosphocreatine metabolic process", "id": "GO:0006603", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006603", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "creatine kinase activity", "id": "GO:0004111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004111", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" }, { "name": "cardiolipin binding", "id": "GO:1901612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901612", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "Q6P8J7", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17157", "name": "", "equation": "ATP + creatine = ADP + H(+) + N-phosphocreatine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07335-1", "P09605-1", "P00564-1", "P25809-1", "P12277-1", "P06732-1", "P12532-1", "P17540-1", "P30275-1", "P07310-1", "Q6P8J7-1", "Q04447-1" ], "evidence": [ { "id": "17157", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17157" } ] }, { "id": "R-MMU-200326", "name": "creatine + ATP => phosphocreatine + ADP [CK octamer]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P30275-1", "Q6P8J7-1" ], "evidence": [ { "id": "R-MMU-200326", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-200326" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P00564", "gene_name": "Ckm", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P00564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00564" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P00564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00564" } ] } ] }, { "uniprot_ac": "P06732", "gene_name": "CKM", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P06732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06732" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P06732", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06732" } ] } ] }, { "uniprot_ac": "P07310", "gene_name": "Ckm", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P07310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07310" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P07310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07310" } ] } ] }, { "uniprot_ac": "P07335", "gene_name": "Ckb", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P07335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07335" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P07335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07335" } ] } ] }, { "uniprot_ac": "P09605", "gene_name": "Ckmt2", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P09605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09605" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P09605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09605" } ] } ] }, { "uniprot_ac": "P12277", "gene_name": "CKB", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P12277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12277" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P12277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12277" } ] } ] }, { "uniprot_ac": "P12532", "gene_name": "CKMT1A", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P12532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12532" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P12532", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12532" } ] } ] }, { "uniprot_ac": "P17540", "gene_name": "CKMT2", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P17540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17540" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P17540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17540" } ] } ] }, { "uniprot_ac": "P25809", "gene_name": "Ckmt1", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P25809", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25809" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P25809", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25809" } ] } ] }, { "uniprot_ac": "P30275", "gene_name": "Ckmt1", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "P30275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30275" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "P30275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30275" } ] } ] }, { "uniprot_ac": "Q04447", "gene_name": "Ckb", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "Q04447", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04447" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "Q04447", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04447" } ] } ] }, { "uniprot_ac": "Q6P8J7", "gene_name": "Ckmt2", "activity": [ { "ec_number": "2.7.3.2", "activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.", "evidence": [ { "id": "Q6P8J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ] }, { "ec_number": "2.7.3.2", "activity": "", "evidence": [ { "id": "Q6P8J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8J7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }