{ "uniprot_canonical_ac": "Q6P7S1-1", "uniprot_ac": "Q6P7S1", "uniprot_id": "ASAH1_RAT", "mass": { "chemical_mass": 44443.0, "monoisotopic_mass": 44443.0 }, "refseq": { "ac": "NP_445859", "name": "acid ceramidase precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859" }, "gene_names": [ { "name": "Asah1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6P7S1", "id": "Q6P7S1" }, { "name": "Asah1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859", "id": "NP_445859" }, { "name": "Asah", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859", "id": "NP_445859" } ], "protein_names": [ { "name": "Acid ceramidase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6P7S1" }, { "name": "3.5.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "3.5.1.23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "ACDase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "AC", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "Acid CDase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "Acylsphingosine deacylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "N-acylethanolamine hydrolase ASAH1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "N-acylsphingosine amidohydrolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6P7S1" }, { "name": "acid ceramidase precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859", "id": "NP_445859" }, { "name": "acid ceramidase; AC; acylsphingosine deacylase; ACDase; acid CDase; N-acylsphingosine amidohydrolase (acid ceramidase) 1; N-acylethanolamine hydrolase ASAH1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859", "id": "NP_445859" } ], "function": [ { "annotation": "Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH (By similarity). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (By similarity). Has a higher catalytic efficiency towards C12-ceramides versus other ceramides (By similarity). Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine (By similarity). For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used (By similarity). Has also an N-acylethanolamine hydrolase activity (By similarity). By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes (By similarity). Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis (By similarity). By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1#function" }, { "database": "UniProtKB", "id": "Q13510", "url": "https://www.uniprot.org/uniprot/Q13510#function" } ] } ], "disease": [ { "disease_id": "DOID:0050464", "recommended_name": { "id": "DOID:0050464", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050464", "name": "Farber lipogranulomatosis", "description": "A lipid storage disease that is characterized by abnormalities in swallowing, cognition, joint function, and central nervous system due to a deficiency in the enzyme ceramidase that results in sphingolipids deposition." }, "synonyms": [ { "id": "DOID:0050464", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050464", "name": "Farber disease", "description": "" }, { "id": "DOID:0050464", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050464", "name": "N-laurylsphingosine deacylase deficiency", "description": "" }, { "id": "DOID:0050464", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050464", "name": "acid ceramidase deficiency", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "Farber lipogranulomatosis", "description": "A rare sphingolipid disorder characterized by a spectrum of clinical signs ranging from the classical triad of painful and progressively deformed joints, subcutaneous nodules, and progressive hoarseness (due to laryngeal involvement) that presents in infancy, to varying phenotypes with respiratory and neurologic involvement." }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "Farber disease", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "Farber lipogranulomatosis", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "N-LAURYLSPHINGOSINE deacylase deficiency", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "acid ceramidase deficiency", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "AC deficiency", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "FRBRL", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "Farber's disease", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "N-Laurylsphingosine deacylase deficiency", "description": "" }, { "id": "MONDO:0009218", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009218", "name": "ceramidase deficiency", "description": "" }, { "id": "MIM:228000", "resource": "MIM", "url": "https://www.omim.org/entry/228000", "name": "Farber lipogranulomatosis", "description": "Farber lipogranulomatosis" } ], "evidence": [ { "id": "0050464", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050464" } ] }, { "disease_id": "DOID:0111527", "recommended_name": { "id": "DOID:0111527", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111527", "name": "spinal muscular atrophy with progressive myoclonic epilepsy", "description": "A motor neuron disease characterized by severe and progressive myoclonic epilepsy and lower-motor-neuron disease that has_material_basis_in homozygous or compound heterozygous mutation in the ASAH1 gene on chromosome 8p22." }, "synonyms": [ { "id": "DOID:0111527", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111527", "name": "Jankovic-Rivera syndrome", "description": "" }, { "id": "DOID:0111527", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111527", "name": "SMA-PME", "description": "" }, { "id": "DOID:0111527", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111527", "name": "SMAPME", "description": "" }, { "id": "DOID:0111527", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111527", "name": "hereditary myoclonus-progressive distal muscular atrophy syndrome", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "spinal muscular atrophy-progressive myoclonic epilepsy syndrome", "description": "Spinal muscular atrophy-progressive myoclonic epilepsy syndrome is characterized by hereditary myoclonus and progressive distal muscular atrophy. Less than 10 cases have been reported. Treatment with clonazepam results in complete and lasting improvement of the myoclonus." }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "Jankovic-Rivera syndrome", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "hereditary myoclonus-progressive distal muscular atrophy syndrome", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "Jankovic Rivera syndrome", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "SMAPME", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "hereditary myoclonus and progressive distal muscular atrophy", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "myoclonus hereditary progressive distal muscular atrophy", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "myoclonus, hereditary, with progressive distal muscular atrophy", "description": "" }, { "id": "MONDO:0008045", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008045", "name": "spinal muscular atrophy with progressive myoclonic epilepsy", "description": "" }, { "id": "MIM:159950", "resource": "MIM", "url": "https://www.omim.org/entry/159950", "name": "Spinal muscular atrophy with progressive myoclonic epilepsy", "description": "Spinal muscular atrophy with progressive myoclonic epilepsy" } ], "evidence": [ { "id": "0111527", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111527" } ] }, { "disease_id": "DOID:1927", "recommended_name": { "id": "DOID:1927", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1927", "name": "sphingolipidosis", "description": "A lipid storage disease characterized by functional deficiencies in the enzymes needed for lysosomal degradation of sphingolipid substrates." }, "synonyms": [ { "id": "DOID:1927", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1927", "name": "sphingolipidoses", "description": "" } ], "evidence": [ { "id": "1927", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1927" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Asah1", "url": "https://www.uniprot.org/uniprot/Q6P7S1", "locus": { "chromosome": "16", "start_pos": 51008233, "end_pos": 50966229, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000010034", "url": "https://www.ensembl.org/id/ENSRNOG00000010034" } ] } } ], "crossref": [ { "id": "ENSRNOG00000010034", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000010034", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.5.1.23", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.5.1.23&UniProtAcc=Q6P7S1", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "3.5.1.60", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.5.1.60&UniProtAcc=Q6P7S1", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01903", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01903", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2331070", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2331070", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "84431", "url": "https://www.ncbi.nlm.nih.gov/gene/84431", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6P7S1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6P7S1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR016699", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016699", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029132", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029132", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:84431", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:84431", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YVIETNY", "url": "https://omabrowser.org/oma/group/YVIETNY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5485766at2759", "url": "http://www.orthodb.org/?query=5485766at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28583", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28583", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28583:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28583:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02275", "url": "http://pfam.xfam.org/family/PF02275", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15508", "url": "http://pfam.xfam.org/family/PF15508", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6P7S1", "url": "http://purl.obolibrary.org/obo/PR_Q6P7S1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_445859", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_445859", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621568", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621568", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "20856", "url": "https://www.rhea-db.org/rhea/20856", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38891", "url": "https://www.rhea-db.org/rhea/38891", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41279", "url": "https://www.rhea-db.org/rhea/41279", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41287", "url": "https://www.rhea-db.org/rhea/41287", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41291", "url": "https://www.rhea-db.org/rhea/41291", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41295", "url": "https://www.rhea-db.org/rhea/41295", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41299", "url": "https://www.rhea-db.org/rhea/41299", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41303", "url": "https://www.rhea-db.org/rhea/41303", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45092", "url": "https://www.rhea-db.org/rhea/45092", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45448", "url": "https://www.rhea-db.org/rhea/45448", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45456", "url": "https://www.rhea-db.org/rhea/45456", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58484", "url": "https://www.rhea-db.org/rhea/58484", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q6P7S1", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0G2K8T0", "url": "https://www.uniprot.org/uniprot/A0A0G2K8T0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K8T0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K8T0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q768", "url": "https://www.uniprot.org/uniprot/A0A8L2Q768", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q768-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q768-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P7S1-1", "url": "https://www.uniprot.org/uniprot/Q6P7S1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMFGKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW", "length": 394, "header": "sp|Q6P7S1-1|ASAH1_RAT Isoform 1 of Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1 CANONICAL=Q6P7S1-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K8T0-1", "url": "", "sequence": { "sequence": "MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMFGKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGWNYKNIRPTAATLTVSGRKTGLRQSFRRNKNFSSS", "length": 428, "header": "tr|A0A0G2K8T0-1|ASAH1_RAT Computationally mapped isoform of Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1 CANONICAL=Q6P7S1-1" }, "locus": { "chromosome": "16", "start_pos": 51008230, "end_pos": 50966438, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077188.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077188.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074724.1", "url": "https://www.ensembl.org/id/ENSRNOP00000074724.1" } ] } }, { "isoform_ac": "A0A8L2Q768-1", "url": "", "sequence": { "sequence": "MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGEWMFGKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW", "length": 388, "header": "tr|A0A8L2Q768-1|ASAH1_RAT Computationally mapped isoform of Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1 CANONICAL=Q6P7S1-1" }, "locus": { "chromosome": "16", "start_pos": 50996780, "end_pos": 50966438, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000013463.5", "url": "https://www.ensembl.org/id/ENSRNOT00000013463.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000013463.5", "url": "https://www.ensembl.org/id/ENSRNOP00000013463.5" } ] } }, { "isoform_ac": "Q6P7S1-1", "url": "", "sequence": { "sequence": "MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMFGKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW", "length": 394, "header": "sp|Q6P7S1-1|ASAH1_RAT Isoform 1 of Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1 CANONICAL=Q6P7S1-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 194, "start_aa": "Asn", "end_pos": 194, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn194", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1#ptm_processing" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "34106099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" }, { "id": "24090084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "34106099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "34106099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" }, { "id": "24090084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-258 ; ASN-258", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "24090084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "34106099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-258 ; ASN-258", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniCarbKB", "url": "" }, { "id": "24090084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1#ptm_processing" }, { "id": "24090084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 341, "start_aa": "Asn", "end_pos": 341, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn341", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_predicted", "glycoprotein_reported" ], "publication": [ { "title": "N-Glycosylation in isolated rat nerve terminals", "journal": "Molecular Omics", "date": "2021", "authors": "Matthies I., Abrahams J.L., Jensen P., Oliveira T., Kolarich D., Larsen M.R.", "evidence": [ { "database": "UniCarbKB", "id": "Q6P7S1", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1039/D0MO00044B", "url": "https://glygen.org/publication/DOI/10.1039/D0MO00044B" } ] }, { "title": "Site-specific glycan-peptide analysis for determination of N-glycoproteome heterogeneity.", "journal": "Journal of proteome research", "date": "2013", "authors": "Parker BL, Thaysen-Andersen M, Solis N, Scott NE, Larsen MR, Graham ME, Packer NH, Cordwell SJ", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1#ptm_processing" }, { "database": "UniProtKB", "id": "A0A0G2K8T0", "url": "https://www.uniprot.org/uniprot/A0A0G2K8T0" }, { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" }, { "database": "UniCarbKB", "id": "Q6P7S1", "url": "" } ], "reference": [ { "type": "PubMed", "id": "24090084", "url": "https://glygen.org/publication/PubMed/24090084" } ] }, { "title": "N-Glycosylation in isolated rat nerve terminals.", "journal": "Molecular omics", "date": "2021", "authors": "Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR", "evidence": [ { "database": "UniCarbKB", "id": "Q6P7S1", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34106099", "url": "https://glygen.org/publication/PubMed/34106099" } ] } ], "pathway": [ { "id": "rno:84431", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:84431", "resource": "KEGG Pathway" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-RNO-9840310", "name": "Glycosphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q13510-1", "protein_name": "Acid ceramidase", "gene_name": "ASAH1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW", "length": 395 }, "evidence": [ { "id": "45228992", "url": "http://www.informatics.jax.org/homology/45228992", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WV54-1", "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRGQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDEKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFVGYVGMLTGFKPGLFSLSLNERFSINGGYLGILEWMFGRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYFILGGKKSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCLNHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW", "length": 394 }, "evidence": [ { "id": "45228992", "url": "http://www.informatics.jax.org/homology/45228992", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "fatty acid amide hydrolase activity", "id": "GO:0017064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017064", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "N-acylsphingosine amidohydrolase activity", "id": "GO:0017040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017040", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "ceramidase activity", "id": "GO:0102121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102121", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides", "id": "GO:0016811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016811", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "sphingosine biosynthetic process", "id": "GO:0046512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046512", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "ceramide catabolic process", "id": "GO:0046514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046514", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "regulation of programmed necrotic cell death", "id": "GO:0062098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062098", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "ceramide biosynthetic process", "id": "GO:0046513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046513", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "lung development", "id": "GO:0030324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030324", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "keratinocyte differentiation", "id": "GO:0030216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030216", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "response to organic substance", "id": "GO:0010033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010033", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" }, { "name": "regulation of steroid biosynthetic process", "id": "GO:0050810", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050810", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "acid ceramidase N-glycosylated 1 (rat)", "definition": "An acid ceramidase (rat) that has been N-glycosylated at the residue equivalent to Asn-258 of the amino acid sequence represented by UniProtKB:Q6P7S1-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:Q6P7S1-1, Asn-258, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:24090084]", "evidence": [ { "id": "PR:000059419", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000059419" } ] }, { "name": "acid ceramidase N-glycosylated 2 (rat)", "definition": "An acid ceramidase (rat) that has been N-glycosylated at the residue equivalent to Asn-258 of the amino acid sequence represented by UniProtKB:Q6P7S1-1, in which the glycan composition is represented by GlyTouCan:G41247ZX. Example: UniProtKB:Q6P7S1-1, Asn-258, MOD:00160~GNO:G41247ZX. [PRO:DNx, PMID:24090084]", "evidence": [ { "id": "PR:000059420", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000059420" } ] }, { "name": "acid ceramidase N-glycosylated 3 (rat)", "definition": "An acid ceramidase (rat) that has been N-glycosylated at the residue equivalent to Asn-258 of the amino acid sequence represented by UniProtKB:Q6P7S1-1, in which the glycan structure is represented by GlyTouCan:G55220VL. Example: UniProtKB:Q6P7S1-1, Asn-258, MOD:00160~GNO:G55220VL. [PRO:DNx, PMID:24090084]", "evidence": [ { "id": "PR:000059421", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000059421" } ] }, { "name": "acid ceramidase N-glycosylated 4 (rat)", "definition": "An acid ceramidase (rat) that has been N-glycosylated at the residue equivalent to Asn-258 of the amino acid sequence represented by UniProtKB:Q6P7S1-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:Q6P7S1-1, Asn-258, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:24090084]", "evidence": [ { "id": "PR:000059422", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000059422" } ] } ], "site_annotation": [ { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" }, { "start_pos": 194, "end_pos": 196, "annotation": "n_glycosylation_sequon" }, { "start_pos": 258, "end_pos": 260, "annotation": "n_glycosylation_sequon" }, { "start_pos": 285, "end_pos": 287, "annotation": "n_glycosylation_sequon" }, { "start_pos": 341, "end_pos": 343, "annotation": "n_glycosylation_sequon" }, { "start_pos": 347, "end_pos": 349, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" }, { "database": "PubMed", "id": "Q13510", "url": "https://glygen.org/publication/PubMed/Q13510" } ] }, { "annotation": "Proteolytically cleaved into two chains alpha and beta that remain associated via a disulfide bond. Cleavage gives rise to a conformation change that activates the enzyme. The same catalytic Cys residue mediates the autoproteolytic cleavage and subsequent hydrolysis of lipid substrates. The beta chain may undergo an additional C-terminal processing.", "evidence": [ { "database": "UniProtKB", "id": "Q6P7S1", "url": "https://www.uniprot.org/uniprot/Q6P7S1" }, { "database": "PubMed", "id": "Q13510", "url": "https://glygen.org/publication/PubMed/Q13510" } ] } ], "interactions": [], "reactions": [ { "id": "20856", "name": "", "equation": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5KTC7-1", "M0R603-1", "A0A8I6ADP7-1", "D3ZNW4-1", "A0A8I6A848-1", "Q5QJU3-1", "Q9NUN7-1", "Q8TDN7-1", "Q9NR71-1", "Q13510-1", "Q02083-1", "Q9JHE3-1", "Q8R4X1-1", "Q8VD53-1", "Q9D099-1", "Q9WV54-1", "Q9D7V9-1", "Q55G11-1", "Q54BK2-1", "Q9VIP7-1", "Q9VA70-1" ], "evidence": [ { "id": "20856", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20856" } ] }, { "id": "38891", "name": "", "equation": "H2O + N-hexadecanoylsphing-4-enine = hexadecanoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5KTC7-1", "Q5QJU3-1", "Q9NR71-1", "Q13510-1", "Q02083-1", "Q8VD53-1", "Q9WV54-1", "Q9JHE3-1", "Q9D7V9-1", "P38298-1" ], "evidence": [ { "id": "38891", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38891" } ] }, { "id": "41279", "name": "", "equation": "H2O + N-octadecanoylsphing-4-enine = octadecanoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5QJU3-1", "Q9NR71-1", "Q13510-1", "Q8VD53-1", "Q9WV54-1", "Q9JHE3-1" ], "evidence": [ { "id": "41279", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41279" } ] }, { "id": "41287", "name": "", "equation": "H2O + N-tetradecanoylsphing-4-enine = sphing-4-enine + tetradecanoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5QJU3-1", "Q9NR71-1", "Q13510-1", "Q8VD53-1", "Q9WV54-1", "Q9JHE3-1" ], "evidence": [ { "id": "41287", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41287" } ] }, { "id": "41291", "name": "", "equation": "H2O + N-dodecanoylsphing-4-enine = dodecanoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5KTC7-1", "Q5QJU3-1", "Q9NR71-1", "Q13510-1", "Q02083-1", "Q8VD53-1", "Q9WV54-1", "Q9JHE3-1", "Q9D7V9-1" ], "evidence": [ { "id": "41291", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41291" } ] }, { "id": "41295", "name": "", "equation": "H2O + N-(hexanoyl)sphing-4-enine = hexanoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q5QJU3-1", "Q9NR71-1", "Q13510-1", "Q8VD53-1", "Q9WV54-1", "Q9JHE3-1" ], "evidence": [ { "id": "41295", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41295" } ] }, { "id": "41299", "name": "", "equation": "H2O + N-(9Z-octadecenoyl)-sphing-4-enine = (9Z)-octadecenoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "M0R603-1", "A0A8I6ADP7-1", "D3ZNW4-1", "A0A8I6A848-1", "Q5QJU3-1", "Q9NUN7-1", "Q8TDN7-1", "Q9NR71-1", "Q13510-1", "Q8R4X1-1", "Q8VD53-1", "Q9D099-1", "Q9WV54-1", "Q9JHE3-1" ], "evidence": [ { "id": "41299", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41299" } ] }, { "id": "41303", "name": "", "equation": "H2O + N-dodecanoyl-(4R)-hydroxysphinganine = (4R)-hydroxysphinganine + dodecanoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q13510-1", "Q9WV54-1" ], "evidence": [ { "id": "41303", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41303" } ] }, { "id": "45092", "name": "", "equation": "H2O + N-octanoylsphing-4-enine = octanoate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q91XT9-1", "Q9NR71-1", "Q13510-1", "Q9WV54-1", "Q9JHE3-1" ], "evidence": [ { "id": "45092", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45092" } ] }, { "id": "45448", "name": "", "equation": "H2O + N-(dodecanoyl)-sphinganine = dodecanoate + sphinganine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q13510-1", "Q9WV54-1" ], "evidence": [ { "id": "45448", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45448" } ] }, { "id": "45456", "name": "", "equation": "H2O + N-dodecanoylethanolamine = dodecanoate + ethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q5KTC7-1", "Q13510-1", "Q02083-1", "Q9WV54-1", "Q9D7V9-1" ], "evidence": [ { "id": "45456", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45456" } ] }, { "id": "58484", "name": "", "equation": "H2O + N-(acetyl)-sphing-4-enine = acetate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P7S1-1", "Q13510-1", "Q9WV54-1" ], "evidence": [ { "id": "58484", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58484" } ] }, { "id": "R-RNO-1606602", "name": "ASAH1 hydrolyzes ceramide", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [ "R-ALL-1606588", "R-ALL-1861779" ], "enzyme_list": [ "Q6P7S1-1" ], "evidence": [ { "id": "R-RNO-1606602", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1606602" } ] }, { "id": "R-RNO-6798745", "name": "Exocytosis of tertiary granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, tertiary granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8K4Y7-1", "P38652-1", "P05065-1", "P81718-1", "P09117-1", "O88766-1", "P50282-1", "A0S5V8-1", "P24268-1", "Q6P7S1-1", "P00697-1", "P30349-1", "P41562-1", "Q497B0-1", "D4AC85-1", "D4AC20-1", "P19132-1", "Q02765-1", "P00762-1", "P00763-1", "Q6IUU3-1", "Q62867-1" ], "evidence": [ { "id": "R-RNO-6798745", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798745" } ] }, { "id": "R-RNO-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P82995-1", "P05197-1", "Q8K4Y7-1", "P63018-1", "P63086-1", "P38652-1", "P09811-1", "P16638-1", "P05065-1", "P50430-1", "Q6P6V0-1", "P97571-1", "P46462-1", "P09117-1", "D4AEH9-1", "F1M1H0-1", "F7FLB2-1", "Q32KJ5-1", "P50282-1", "D3ZUM4-1", "P00787-1", "P04762-1", "P06760-1", "P24268-1", "P32038-1", "Q6P7S1-1", "D3ZLZ7-1", "E9PU28-1", "P19804-1", "P27926-1", "P30349-1", "P41562-1", "D4AC85-1", "M0RD14-1", "D4ADE8-1", "D4AC20-1", "O09178-1", "P13676-1", "P19132-1", "P62630-1", "P10111-1", "P25113-1", "P30835-1", "P85973-1", "Q9JHW0-1", "Q9Z0V5-1", "Q02765-1", "Q9R1T3-1", "O35264-1", "P12527-1", "O08730-1", "P04906-1", "P06214-1", "P30904-1", "P70618-1" ], "evidence": [ { "id": "R-RNO-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6800434" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1606588", "participant_name": "SPG [lysosomal lumen]", "crossref": [ { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" }, { "id": "84410", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1861779", "participant_name": "RCOO- [lysosomal lumen]", "crossref": [ { "id": "28868", "database": "ChEBI", "url": "" }, { "id": "C02403", "database": "COMPOUND", "url": "" }, { "id": "28868", "database": "ChEBI", "url": "" }, { "id": "C02403", "database": "COMPOUND", "url": "" }, { "id": "28868", "database": "ChEBI", "url": "" }, { "id": "C02403", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6A848", "gene_name": "ENSRNOG00000069695", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "A0A8I6A848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A848" } ] } ] }, { "uniprot_ac": "A0A8I6ADP7", "gene_name": "Acer3", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "A0A8I6ADP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ADP7" } ] } ] }, { "uniprot_ac": "A0S5V8", "gene_name": "Chit1", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "A0S5V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0S5V8" } ] }, { "ec_number": "3.2.1.14", "activity": "", "evidence": [ { "id": "A0S5V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0S5V8" } ] } ] }, { "uniprot_ac": "D3ZLZ7", "gene_name": "Impdh1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "D3ZLZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLZ7" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "D3ZLZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLZ7" } ] } ] }, { "uniprot_ac": "D3ZNW4", "gene_name": "Acer2", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "D3ZNW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZNW4" } ] } ] }, { "uniprot_ac": "D3ZUM4", "gene_name": "Glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "D3ZUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZUM4" } ] } ] }, { "uniprot_ac": "D4AC20", "gene_name": "Cda", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "D4AC20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC20" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "D4AC20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC20" } ] } ] }, { "uniprot_ac": "D4AC85", "gene_name": "Qpct", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "D4AC85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC85" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "D4AC85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC85" } ] } ] }, { "uniprot_ac": "D4ADE8", "gene_name": "Ddx3x", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "D4ADE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE8" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "D4ADE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE8" } ] } ] }, { "uniprot_ac": "D4AEH9", "gene_name": "Agl", "activity": [ { "ec_number": "2.4.1.25", "activity": "Transfers a segment of a (1->4)-alpha-D-glucan to a new position in an acceptor, which may be glucose or a (1->4)-alpha-D-glucan.", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "3.2.1.33", "activity": "Hydrolysis of (1->6)-alpha-D-glucosidic branch linkages in glycogen phosphorylase limit dextrin.", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "3.2.1.33", "activity": "", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] }, { "ec_number": "2.4.1.25", "activity": "", "evidence": [ { "id": "D4AEH9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AEH9" } ] } ] }, { "uniprot_ac": "E9PU28", "gene_name": "Impdh2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "E9PU28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU28" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "E9PU28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PU28" } ] } ] }, { "uniprot_ac": "F1M1H0", "gene_name": "Dera", "activity": [ { "ec_number": "4.1.2.4", "activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.", "evidence": [ { "id": "F1M1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M1H0" } ] }, { "ec_number": "4.1.2.4", "activity": "", "evidence": [ { "id": "F1M1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M1H0" } ] } ] }, { "uniprot_ac": "F7FLB2", "gene_name": "Pgm2", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "F7FLB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FLB2" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "F7FLB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FLB2" } ] } ] }, { "uniprot_ac": "M0R603", "gene_name": "Acer1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "M0R603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R603" } ] } ] }, { "uniprot_ac": "M0RD14", "gene_name": "LOC100362738", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "M0RD14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD14" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "M0RD14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RD14" } ] } ] }, { "uniprot_ac": "O08730", "gene_name": "Gyg1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] } ] }, { "uniprot_ac": "O09178", "gene_name": "Ampd3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "O09178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09178" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "O09178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09178" } ] } ] }, { "uniprot_ac": "O35264", "gene_name": "Pafah1b2", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "O35264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35264" } ] }, { "ec_number": "3.1.1.47", "activity": "", "evidence": [ { "id": "O35264", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35264" } ] } ] }, { "uniprot_ac": "O88766", "gene_name": "Mmp8", "activity": [ { "ec_number": "3.4.24.34", "activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.", "evidence": [ { "id": "O88766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88766" } ] }, { "ec_number": "3.4.24.34", "activity": "", "evidence": [ { "id": "O88766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88766" } ] } ] }, { "uniprot_ac": "P00697", "gene_name": "Lyz1", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P00697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00697" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P00697", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00697" } ] } ] }, { "uniprot_ac": "P00762", "gene_name": "Prss1", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00762" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P00762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00762" } ] } ] }, { "uniprot_ac": "P00763", "gene_name": "Prss2", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P00763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00763" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P00763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00763" } ] } ] }, { "uniprot_ac": "P00787", "gene_name": "Ctsb", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "P00787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00787" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "P00787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00787" } ] } ] }, { "uniprot_ac": "P04762", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04762" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P05065", "gene_name": "Aldoa", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05065" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05065" } ] } ] }, { "uniprot_ac": "P05197", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P05197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05197" } ] } ] }, { "uniprot_ac": "P06214", "gene_name": "Alad", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "P06214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06214" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "P06214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06214" } ] } ] }, { "uniprot_ac": "P06760", "gene_name": "Gusb", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P06760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06760" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P06760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06760" } ] } ] }, { "uniprot_ac": "P09117", "gene_name": "Aldoc", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P09117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09117" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P09117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09117" } ] } ] }, { "uniprot_ac": "P09811", "gene_name": "Pygl", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "P09811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09811" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "P09811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09811" } ] } ] }, { "uniprot_ac": "P10111", "gene_name": "Ppia", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P10111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10111" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P10111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10111" } ] } ] }, { "uniprot_ac": "P12527", "gene_name": "Alox5", "activity": [ { "ec_number": "1.13.11.-", "activity": "", "evidence": [ { "id": "P12527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12527" } ] }, { "ec_number": "1.13.11.34", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.", "evidence": [ { "id": "P12527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12527" } ] } ] }, { "uniprot_ac": "P13676", "gene_name": "Apeh", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "P13676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13676" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "P13676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13676" } ] } ] }, { "uniprot_ac": "P16638", "gene_name": "Acly", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "P16638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16638" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "P16638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16638" } ] } ] }, { "uniprot_ac": "P19132", "gene_name": "Fth1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P19132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19132" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P19132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19132" } ] } ] }, { "uniprot_ac": "P19804", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P19804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19804" } ] } ] }, { "uniprot_ac": "P24268", "gene_name": "Ctsd", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P24268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24268" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P24268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24268" } ] } ] }, { "uniprot_ac": "P25113", "gene_name": "Pgam1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "P25113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25113" } ] } ] }, { "uniprot_ac": "P27926", "gene_name": "Hk3", "activity": [ { "ec_number": "2.7.1.1", "activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).", "evidence": [ { "id": "P27926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27926" } ] }, { "ec_number": "2.7.1.1", "activity": "", "evidence": [ { "id": "P27926", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27926" } ] } ] }, { "uniprot_ac": "P30349", "gene_name": "Lta4h", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P30349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30349" } ] } ] }, { "uniprot_ac": "P30835", "gene_name": "Pfkl", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "P30835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30835" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "P30835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30835" } ] } ] }, { "uniprot_ac": "P30904", "gene_name": "Mif", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] } ] }, { "uniprot_ac": "P32038", "gene_name": "Cfd", "activity": [ { "ec_number": "3.4.21.46", "activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.", "evidence": [ { "id": "P32038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32038" } ] }, { "ec_number": "3.4.21.46", "activity": "", "evidence": [ { "id": "P32038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32038" } ] } ] }, { "uniprot_ac": "P38298", "gene_name": "YPC1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "P38298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38298" } ] } ] }, { "uniprot_ac": "P38652", "gene_name": "Pgm1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "P38652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38652" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "P38652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38652" } ] } ] }, { "uniprot_ac": "P41562", "gene_name": "Idh1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "P41562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41562" } ] } ] }, { "uniprot_ac": "P46462", "gene_name": "Vcp", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] } ] }, { "uniprot_ac": "P50282", "gene_name": "Mmp9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P50282", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50282" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P50282", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50282" } ] } ] }, { "uniprot_ac": "P50430", "gene_name": "Arsb", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P50430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50430" } ] } ] }, { "uniprot_ac": "P62630", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62630" } ] } ] }, { "uniprot_ac": "P63018", "gene_name": "Hspa8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] } ] }, { "uniprot_ac": "P63086", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63086", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63086" } ] } ] }, { "uniprot_ac": "P70618", "gene_name": "Mapk14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P70618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70618" } ] } ] }, { "uniprot_ac": "P81718", "gene_name": "Ptpn6", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P81718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81718" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P81718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81718" } ] } ] }, { "uniprot_ac": "P82995", "gene_name": "Hsp90aa1", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P82995", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82995" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P82995", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82995" } ] } ] }, { "uniprot_ac": "P85973", "gene_name": "Pnp", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "P85973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85973" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "P85973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P85973" } ] } ] }, { "uniprot_ac": "P97571", "gene_name": "Capn1", "activity": [ { "ec_number": "3.4.22.52", "activity": "Broad endopeptidase specificity.", "evidence": [ { "id": "P97571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97571" } ] }, { "ec_number": "3.4.22.52", "activity": "", "evidence": [ { "id": "P97571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97571" } ] } ] }, { "uniprot_ac": "Q02083", "gene_name": "NAAA", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q02083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02083" } ] }, { "ec_number": "3.5.1.60", "activity": "H2O + N-(long-chain fatty acyl)ethanolamine = a long-chain fatty acid + ethanolamine.", "evidence": [ { "id": "Q02083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02083" } ] }, { "ec_number": "3.5.1.60", "activity": "", "evidence": [ { "id": "Q02083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02083" } ] } ] }, { "uniprot_ac": "Q02765", "gene_name": "Ctss", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "Q02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02765" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "Q02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02765" } ] } ] }, { "uniprot_ac": "Q13510", "gene_name": "ASAH1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] } ] }, { "uniprot_ac": "Q32KJ5", "gene_name": "Gns", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "Q32KJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ5" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "Q32KJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32KJ5" } ] } ] }, { "uniprot_ac": "Q497B0", "gene_name": "Nit2", "activity": [ { "ec_number": "3.5.1.3", "activity": "a monoamide of a dicarboxylate + H2O = a dicarboxylate + NH4(+).", "evidence": [ { "id": "Q497B0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q497B0" } ] }, { "ec_number": "3.5.1.3", "activity": "", "evidence": [ { "id": "Q497B0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q497B0" } ] } ] }, { "uniprot_ac": "Q54BK2", "gene_name": "dcd2A", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q54BK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BK2" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q54BK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BK2" } ] } ] }, { "uniprot_ac": "Q55G11", "gene_name": "dcd2B", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q55G11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55G11" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q55G11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55G11" } ] } ] }, { "uniprot_ac": "Q5KTC7", "gene_name": "Naaa", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q5KTC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5KTC7" } ] }, { "ec_number": "3.5.1.60", "activity": "H2O + N-(long-chain fatty acyl)ethanolamine = a long-chain fatty acid + ethanolamine.", "evidence": [ { "id": "Q5KTC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5KTC7" } ] }, { "ec_number": "3.5.1.60", "activity": "", "evidence": [ { "id": "Q5KTC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5KTC7" } ] } ] }, { "uniprot_ac": "Q5QJU3", "gene_name": "ACER2", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q5QJU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5QJU3" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q5QJU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5QJU3" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q5QJU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5QJU3" } ] } ] }, { "uniprot_ac": "Q62867", "gene_name": "Ggh", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q62867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62867" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q62867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62867" } ] } ] }, { "uniprot_ac": "Q6IUU3", "gene_name": "Qsox1", "activity": [ { "ec_number": "1.8.3.2", "activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.", "evidence": [ { "id": "Q6IUU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IUU3" } ] }, { "ec_number": "1.8.3.2", "activity": "", "evidence": [ { "id": "Q6IUU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IUU3" } ] } ] }, { "uniprot_ac": "Q6P6V0", "gene_name": "Gpi", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "Q6P6V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6V0" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "Q6P6V0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6V0" } ] } ] }, { "uniprot_ac": "Q6P7S1", "gene_name": "Asah1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q6P7S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7S1" } ] } ] }, { "uniprot_ac": "Q8K4Y7", "gene_name": "Cant1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8K4Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4Y7" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8K4Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4Y7" } ] } ] }, { "uniprot_ac": "Q8R4X1", "gene_name": "Acer1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q8R4X1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4X1" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8R4X1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4X1" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q8R4X1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4X1" } ] } ] }, { "uniprot_ac": "Q8TDN7", "gene_name": "ACER1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q8TDN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDN7" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8TDN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDN7" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q8TDN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TDN7" } ] } ] }, { "uniprot_ac": "Q8VD53", "gene_name": "Acer2", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q8VD53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD53" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8VD53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD53" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q8VD53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD53" } ] } ] }, { "uniprot_ac": "Q91XT9", "gene_name": "Asah2", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q91XT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XT9" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q91XT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XT9" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q91XT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XT9" } ] } ] }, { "uniprot_ac": "Q9D099", "gene_name": "Acer3", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9D099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D099" } ] }, { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9D099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D099" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9D099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D099" } ] } ] }, { "uniprot_ac": "Q9D7V9", "gene_name": "Naaa", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9D7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7V9" } ] }, { "ec_number": "3.5.1.60", "activity": "H2O + N-(long-chain fatty acyl)ethanolamine = a long-chain fatty acid + ethanolamine.", "evidence": [ { "id": "Q9D7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7V9" } ] }, { "ec_number": "3.5.1.60", "activity": "", "evidence": [ { "id": "Q9D7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7V9" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9D7V9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7V9" } ] } ] }, { "uniprot_ac": "Q9JHE3", "gene_name": "Asah2", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9JHE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHE3" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9JHE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHE3" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9JHE3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHE3" } ] } ] }, { "uniprot_ac": "Q9JHW0", "gene_name": "Psmb7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q9JHW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW0" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q9JHW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW0" } ] } ] }, { "uniprot_ac": "Q9NR71", "gene_name": "ASAH2", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9NR71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR71" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9NR71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR71" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9NR71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR71" } ] } ] }, { "uniprot_ac": "Q9NUN7", "gene_name": "ACER3", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9NUN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUN7" } ] }, { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9NUN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUN7" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9NUN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUN7" } ] } ] }, { "uniprot_ac": "Q9R1T3", "gene_name": "Ctsz", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9R1T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T3" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9R1T3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1T3" } ] } ] }, { "uniprot_ac": "Q9VA70", "gene_name": "CDase", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9VA70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA70" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9VA70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VA70" } ] } ] }, { "uniprot_ac": "Q9VIP7", "gene_name": "bwa", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9VIP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIP7" } ] }, { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9VIP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIP7" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9VIP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIP7" } ] } ] }, { "uniprot_ac": "Q9WV54", "gene_name": "Asah1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] } ] }, { "uniprot_ac": "Q9Z0V5", "gene_name": "Prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }