{ "uniprot_canonical_ac": "Q6NZH9-1", "uniprot_ac": "Q6NZH9", "uniprot_id": "Q6NZH9_MOUSE", "mass": { "chemical_mass": 78149.0, "monoisotopic_mass": 78149.0 }, "refseq": { "ac": "NP_001159965", "name": "ras guanyl-releasing protein 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" }, "gene_names": [ { "name": "Rasgrp3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6NZH9", "id": "Q6NZH9" }, { "name": "Gm327", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965", "id": "NP_001159965" }, { "name": "Rasgrp3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965", "id": "NP_001159965" } ], "protein_names": [ { "name": "RAS, guanyl releasing protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6NZH9" }, { "name": "ras guanyl-releasing protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965", "id": "NP_001159965" } ], "function": [ { "annotation": "RasGRP1, but not RasGRP3, is required for thymocyte positive selection and invariant natural killer T cell selection.", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" }, { "database": "PubMed", "id": "23308188", "url": "https://glygen.org/publication/PubMed/23308188" } ] }, { "annotation": "RasGRP1/3-deficient progenitors show impaired migration toward the CCR9 ligand, CCL25, suggesting that RasGRP1 and RasGRP3 may regulate progenitor entry into the thymus through a CCR9-dependent mechanism.", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" }, { "database": "PubMed", "id": "27465532", "url": "https://glygen.org/publication/PubMed/27465532" } ] }, { "annotation": "RasGRP3 is specifically required for GNAQ/GNA11-driven Ras activation and tumorigenesis. Erratum:[Cell Rep. 2020 Oct 13;33(2):108277. PMID: 33053353]", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" }, { "database": "PubMed", "id": "29490280", "url": "https://glygen.org/publication/PubMed/29490280" } ] }, { "annotation": "RasGRP3 limits inflammatory response by activating Rap1 on low-intensity pathogen infection, setting a threshold for preventing excessive inflammatory response. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" }, { "database": "PubMed", "id": "25118589", "url": "https://glygen.org/publication/PubMed/25118589" } ] } ], "disease": [ { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rasgrp3", "url": "https://www.uniprot.org/uniprot/Q6NZH9", "locus": { "chromosome": "17", "start_pos": 75836049, "end_pos": 75742891, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000071042", "url": "https://www.ensembl.org/id/ENSMUSG00000071042" } ] } } ], "crossref": [ { "id": "ENSMUSG00000071042", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000071042", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00155", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00155", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06224", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06224", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20862", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20862", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "240168", "url": "https://www.ncbi.nlm.nih.gov/gene/240168", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000651", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000651", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001895", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001895", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002219", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002219", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036964", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036964", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046349", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046349", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:240168", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:240168", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3028579", "url": "http://www.informatics.jax.org/marker/MGI:3028579", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MYRDASG", "url": "https://omabrowser.org/oma/group/MYRDASG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4260488at2759", "url": "http://www.orthodb.org/?query=4260488at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23113", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23113", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23113:SF178", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23113:SF178", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00130", "url": "http://pfam.xfam.org/family/PF00130", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00617", "url": "http://pfam.xfam.org/family/PF00617", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13202", "url": "http://pfam.xfam.org/family/PF13202", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1169092", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169092", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3Q4EC09", "url": "https://www.uniprot.org/uniprot/A0A3Q4EC09", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EC09-1", "url": "https://www.uniprot.org/uniprot/A0A3Q4EC09-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EG32", "url": "https://www.uniprot.org/uniprot/A0A3Q4EG32", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EG32-1", "url": "https://www.uniprot.org/uniprot/A0A3Q4EG32-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6NZH9-1", "url": "https://www.uniprot.org/uniprot/Q6NZH9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDISSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTVQAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG", "length": 691, "header": "tr|Q6NZH9-1|Q6NZH9_MOUSE Isoform 1 of RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=1 SV=1 CANONICAL=Q6NZH9-1" }, "isoforms": [ { "isoform_ac": "A0A3Q4EC09-1", "url": "", "sequence": { "sequence": "MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLL", "length": 56, "header": "tr|A0A3Q4EC09-1|A0A3Q4EC09_MOUSE Computationally mapped isoform of RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=4 SV=1 CANONICAL=Q6NZH9-1" }, "locus": { "chromosome": "17", "start_pos": 75801239, "end_pos": 75798886, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000234660.2", "url": "https://www.ensembl.org/id/ENSMUST00000234660.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000157183.2", "url": "https://www.ensembl.org/id/ENSMUSP00000157183.2" } ] } }, { "isoform_ac": "A0A3Q4EG32-1", "url": "", "sequence": { "sequence": "MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYRNASGESCDE", "length": 69, "header": "tr|A0A3Q4EG32-1|A0A3Q4EG32_MOUSE Computationally mapped isoform of RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=4 SV=1 CANONICAL=Q6NZH9-1" }, "locus": { "chromosome": "17", "start_pos": 75803410, "end_pos": 75798886, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000234011.2", "url": "https://www.ensembl.org/id/ENSMUST00000234011.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156978.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156978.2" } ] } }, { "isoform_ac": "Q6NZH9-1", "url": "", "sequence": { "sequence": "MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDISSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTVQAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG", "length": 691, "header": "tr|Q6NZH9-1|Q6NZH9_MOUSE Isoform 1 of RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=1 SV=1 CANONICAL=Q6NZH9-1" }, "locus": { "chromosome": "17", "start_pos": 75833843, "end_pos": 75798886, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000095204.6", "url": "https://www.ensembl.org/id/ENSMUST00000095204.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000092828.5", "url": "https://www.ensembl.org/id/ENSMUSP00000092828.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "RasGRP1, but not RasGRP3, is required for efficient thymic beta-selection and ERK activation downstream of CXCR4.", "journal": "PloS one", "date": "2013", "authors": "Golec DP, Dower NA, Stone JC, Baldwin TA", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" } ], "reference": [ { "type": "PubMed", "id": "23308188", "url": "https://glygen.org/publication/PubMed/23308188" } ] }, { "title": "RasGRP3 limits Toll-like receptor-triggered inflammatory response in macrophages by activating Rap1 small GTPase.", "journal": "Nature communications", "date": "2014", "authors": "Tang S, Chen T, Yu Z, Zhu X, Yang M, Xie B, Li N, Cao X, Wang J", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" } ], "reference": [ { "type": "PubMed", "id": "25118589", "url": "https://glygen.org/publication/PubMed/25118589" } ] }, { "title": "RasGRP1 and RasGRP3 Are Required for Efficient Generation of Early Thymic Progenitors.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Golec DP, Henao Caviedes LM, Baldwin TA", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" } ], "reference": [ { "type": "PubMed", "id": "27465532", "url": "https://glygen.org/publication/PubMed/27465532" } ] }, { "title": "GNA11 Q209L Mouse Model Reveals RasGRP3 as an Essential Signaling Node in Uveal Melanoma.", "journal": "Cell reports", "date": "2018", "authors": "Moore AR, Ran L, Guan Y, Sher JJ, Hitchman TD, Zhang JQ, Hwang C, Walzak EG, Shoushtari AN, Monette S, Murali R, Wiesner T, Griewank KG, Chi P, Chen Y", "evidence": [ { "database": "RefSeq", "id": "NP_001159965", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001159965" } ], "reference": [ { "type": "PubMed", "id": "29490280", "url": "https://glygen.org/publication/PubMed/29490280" } ] } ], "pathway": [ { "id": "mmu:240168", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:240168", "resource": "KEGG Pathway" }, { "id": "R-MMU-1169092", "name": "Activation of RAS in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169092", "resource": "Reactome", "description": "Activation of RAS in B cells" }, { "id": "R-MMU-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2KAU4-1", "protein_name": "RAS guanyl releasing protein 3", "gene_name": "Rasgrp3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSNGLGKAATLDELLSTCIEMFDDNGELNDSYLPRIMLLMHRWYLSSTELAGKLLCMYRNASGESCDEFRLKICYFMRYWITKFPAEFNLDLGLIRMTEEFREVASQLGYEKHSNLMDISSIPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRLARAPSLSSNPESLPGSPALPPVQDEVFEFPGVTARHRDLDSRDITLVTGSSRKISVRVQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKLHDKAAKDKGFAKWENEKPTLHAGVDVVDRGTAFEPDQDDEQDEAQQGVEDG", "length": 691 }, "evidence": [ { "id": "45236582", "url": "http://www.informatics.jax.org/homology/45236582", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8IV61-1", "protein_name": "Ras guanyl-releasing protein 3", "gene_name": "RASGRP3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG", "length": 690 }, "evidence": [ { "id": "45236582", "url": "http://www.informatics.jax.org/homology/45236582", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "guanyl-nucleotide exchange factor activity", "id": "GO:0005085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005085", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "guanyl-nucleotide exchange factor complex", "id": "GO:0032045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032045", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "regulation of GTPase activity", "id": "GO:0043087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043087", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" }, { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "Q6NZH9", "url": "https://www.uniprot.org/uniprot/Q6NZH9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 30, "end_pos": 32, "annotation": "n_glycosylation_sequon" }, { "start_pos": 345, "end_pos": 347, "annotation": "n_glycosylation_sequon" }, { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }