{ "uniprot_canonical_ac": "Q6MFY8-1", "uniprot_ac": "Q6MFY8", "uniprot_id": "TRI40_RAT", "mass": { "chemical_mass": 28389.0, "monoisotopic_mass": 28389.0 }, "refseq": { "ac": "NP_001009175", "name": "E3 ubiquitin ligase TRIM40", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175" }, "gene_names": [ { "name": "Trim40", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6MFY8", "id": "Q6MFY8" }, { "name": "Rnf35", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175", "id": "NP_001009175" }, { "name": "Rnf35", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6MFY8", "id": "Q6MFY8" }, { "name": "Trim40", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175", "id": "NP_001009175" } ], "protein_names": [ { "name": "E3 ubiquitin ligase TRIM40", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6MFY8" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6MFY8" }, { "name": "E3 ubiquitin ligase TRIM40", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175", "id": "NP_001009175" }, { "name": "Probable E3 NEDD8-protein ligase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6MFY8" }, { "name": "RING finger protein 35", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6MFY8" }, { "name": "tripartite motif-containing protein 40; RING finger protein 35; tripartite motif protein 40; probable E3 NEDD8-protein ligase; tripartite motif-containing protein 40-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175", "id": "NP_001009175" } ], "function": [ { "annotation": "E3 ubiquitin-protein ligase that plays a role in the limitation of the innate immune response. Mediates inhibition of the RLR signaling pathway by ubiquitinating RIGI and IFIH1 receptors, leading to their proteasomal degradation. Promotes also the neddylation of IKBKG/NEMO, stabilizing NFKBIA, and thereby inhibiting of NF-kappa-B nuclear translocation and activation.", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8#function" }, { "database": "UniProtKB", "id": "Q6P9F5", "url": "https://www.uniprot.org/uniprot/Q6P9F5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "common_name": "Rat" } ], "gene": [ { "name": "Trim40", "url": "https://www.uniprot.org/uniprot/Q6MFY8", "locus": { "chromosome": "20", "start_pos": 1685214, "end_pos": 1676270, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000000783", "url": "https://www.ensembl.org/id/ENSRNOG00000000783" } ] } } ], "crossref": [ { "id": "ENSRNOG00000000783", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000000783", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16583", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16583", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "365528", "url": "https://www.ncbi.nlm.nih.gov/gene/365528", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000315", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000315", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018957", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018957", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:365528", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:365528", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CLESPEH", "url": "https://omabrowser.org/oma/group/CLESPEH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3453019at2759", "url": "http://www.orthodb.org/?query=3453019at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24103", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24103", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24103:SF564", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24103:SF564", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00097", "url": "http://pfam.xfam.org/family/PF00097", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6MFY8", "url": "http://purl.obolibrary.org/obo/PR_Q6MFY8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001009175", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009175", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1359645", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1359645", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6MFY8-1", "url": "https://www.uniprot.org/uniprot/Q6MFY8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVPLDKDNQDICPICLDPLKEAVSTDCRHLFCRMCLIRHMDKASVSGVLSCPVCRKPCSETVLGDNYICHTHQKRVCRFCESSRHLLCEECLQSPEHRAHTELSIENAISHYKERLNRRSRKLRKDLGDLQRLKAQEEKMLQALQVDWGSHRPRTEQQNQDQTELQQKALPRHWLDQREDPPEEVAKVFNFSEAVTQLSILVSSLERMAKELDASTLKDASDLLDRSSQQKLEGLLSHVPPANSKLS", "length": 247, "header": "sp|Q6MFY8-1|TRI40_RAT Isoform 1 of E3 ubiquitin ligase TRIM40 OS=Rattus norvegicus OX=10116 GN=Trim40 PE=3 SV=1 CANONICAL=Q6MFY8-1" }, "isoforms": [ { "isoform_ac": "Q6MFY8-1", "url": "", "sequence": { "sequence": "MVPLDKDNQDICPICLDPLKEAVSTDCRHLFCRMCLIRHMDKASVSGVLSCPVCRKPCSETVLGDNYICHTHQKRVCRFCESSRHLLCEECLQSPEHRAHTELSIENAISHYKERLNRRSRKLRKDLGDLQRLKAQEEKMLQALQVDWGSHRPRTEQQNQDQTELQQKALPRHWLDQREDPPEEVAKVFNFSEAVTQLSILVSSLERMAKELDASTLKDASDLLDRSSQQKLEGLLSHVPPANSKLS", "length": 247, "header": "sp|Q6MFY8-1|TRI40_RAT Isoform 1 of E3 ubiquitin ligase TRIM40 OS=Rattus norvegicus OX=10116 GN=Trim40 PE=3 SV=1 CANONICAL=Q6MFY8-1" }, "locus": { "chromosome": "20", "start_pos": 1685079, "end_pos": 1676399, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000029070", "url": "https://www.ensembl.org/id/ENSRNOT00000029070" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000035419", "url": "https://www.ensembl.org/id/ENSRNOP00000035419" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genomic sequence and comparative analysis of the rat major histocompatibility complex.", "journal": "Genome Res.", "date": "2004", "authors": "Hurt P, Walter L, Sudbrak R, Klages S, Muller I, Shiina T, Inoko H, Lehrach H, Gunther E, Reinhardt R, Himmelbauer H", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "reference": [ { "type": "PubMed", "id": "15060004", "url": "https://glygen.org/publication/PubMed/15060004" } ] } ], "pathway": [ { "id": "rno:365528", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:365528", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3UWA4-1", "protein_name": "E3 ubiquitin ligase TRIM40", "gene_name": "Trim40", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGSLDKDNQDICPICLDPLKEAVSTDCRHLFCRMCLTQHMDKASVSGILSCPVCRKPCSEGVLGDNYICHTHQKRVRRFCEASGHLLCEECLQSPEHQSHTELSIENAISHYKERLNRRSRKLRKDLGNLQQLKAQEKKMLQALQVDCECHRLRTDLQNQDQTKEQLKALPWHWLDQEDLPEEVAKIFSFSEAVTQLSILVSGLERMAKDLDASTLKDASDLLDRSAPQKLEGLLSRVSPAGPKLS", "length": 246 }, "evidence": [ { "id": "45231138", "url": "http://www.informatics.jax.org/homology/45231138", "database": "MGI" }, { "id": "Q6MFY8", "url": "https://omabrowser.org/oma/group/Q6MFY8/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P9F5-1", "protein_name": "E3 ubiquitin ligase TRIM40", "gene_name": "TRIM40", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL", "length": 258 }, "evidence": [ { "id": "45231138", "url": "http://www.informatics.jax.org/homology/45231138", "database": "MGI" }, { "id": "Q6MFY8", "url": "https://omabrowser.org/oma/group/Q6MFY8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "IkappaB kinase complex", "id": "GO:0008385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008385", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "negative regulation of protein localization to nucleus", "id": "GO:1900181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900181", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "negative regulation of NF-kappaB transcription factor activity", "id": "GO:0032088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032088", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "negative regulation of cell growth", "id": "GO:0030308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "negative regulation of protein catabolic process", "id": "GO:0042177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042177", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" }, { "name": "protein neddylation", "id": "GO:0045116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045116", "evidence": [ { "database": "UniProtKB", "id": "Q6MFY8", "url": "https://www.uniprot.org/uniprot/Q6MFY8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }