{ "uniprot_canonical_ac": "Q6LED0-1", "uniprot_ac": "Q6LED0", "uniprot_id": "H31_RAT", "mass": { "chemical_mass": 15404.0, "monoisotopic_mass": 15404.0 }, "refseq": { "ac": "NP_001013074", "name": "histone H3.1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074" }, "gene_names": [ { "name": "H3 histone; Hist1h2ail", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074", "id": "NP_001013074" }, { "name": "Hist1h2ail1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074", "id": "NP_001013074" } ], "protein_names": [ { "name": "Histone H3.1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6LED0" }, { "name": "histone 1, H2ai; histone cluster 1, H2ai-like1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074", "id": "NP_001013074" }, { "name": "histone H3.1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074", "id": "NP_001013074" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "common_name": "Rat" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q6LED0", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000046144", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046144", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "291159", "url": "https://www.ncbi.nlm.nih.gov/gene/291159", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "679994", "url": "https://www.ncbi.nlm.nih.gov/gene/679994", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q6LED0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6LED0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:291159", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291159", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "rno:679994", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679994", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LARRIXS", "url": "https://omabrowser.org/oma/group/LARRIXS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5319100at2759", "url": "http://www.orthodb.org/?query=5319100at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11426", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11426:SF242", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426:SF242", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00125", "url": "http://pfam.xfam.org/family/PF00125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6LED0", "url": "http://purl.obolibrary.org/obo/PR_Q6LED0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1266695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-201722", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-212300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2299718", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214842", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214847", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3247509", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427359", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427413", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5250924", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5578749", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5625886", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73728", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73772", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8936459", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001013074", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013074", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6LED0-1", "url": "https://www.uniprot.org/uniprot/Q6LED0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136, "header": "sp|Q6LED0-1|H31_RAT Isoform 1 of Histone H3.1 OS=Rattus norvegicus OX=10116 GN= PE=1 SV=3 CANONICAL=Q6LED0-1" }, "isoforms": [ { "isoform_ac": "Q6LED0-1", "url": "", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136, "header": "sp|Q6LED0-1|H31_RAT Isoform 1 of Histone H3.1 OS=Rattus norvegicus OX=10116 GN= PE=1 SV=3 CANONICAL=Q6LED0-1" }, "locus": { "chromosome": "17", "start_pos": 42799094, "end_pos": 42798687, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095973", "url": "https://www.ensembl.org/id/ENSRNOT00000095973" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000096532", "url": "https://www.ensembl.org/id/ENSRNOP00000096532" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Thr108" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "iPTMnet", "id": "Q6LED0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6LED0" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" } ], "site_lbl": "Ser11" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC and CHEK1", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "iPTMnet", "id": "Q6LED0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6LED0" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" } ], "site_lbl": "Thr12" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Ser29" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Tyr42" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HASPIN", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Thr4" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Ser58" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Thr7" }, { "start_pos": 81, "end_pos": 81, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Thr81" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.", "journal": "Nucleic Acids Res.", "date": "2003", "authors": "Preuss U, Landsberg G, Scheidtmann KH", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "iPTMnet", "id": "Q6LED0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6LED0" } ], "reference": [ { "type": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" } ] }, { "title": "Dopaminylation of histone H3 in ventral tegmental area regulates cocaine seeking.", "journal": "Science", "date": "2020", "authors": "Lepack AE, Werner CT, Stewart AF, Fulton SL, Zhong P, Farrelly LA, Smith ACW, Ramakrishnan A, Lyu Y, Bastle RM, Martin JA, Mitra S, O'Connor RM, Wang ZJ, Molina H, Turecki G, Shen L, Yan Z, Calipari ES, Dietz DM, Kenny PJ, Maze I", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "reference": [ { "type": "PubMed", "id": "32273471", "url": "https://glygen.org/publication/PubMed/32273471" } ] }, { "title": "A B2-L1 composite between rat histone H2A and H3 genes.", "journal": "Mamm. Genome", "date": "1994", "authors": "Choi Y.C., Chae C.-B., Han B.D.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "reference": [ { "type": "PubMed", "id": "8111130", "url": "https://glygen.org/publication/PubMed/8111130" } ] }, { "title": "Ubiquitination of histone H3 in elongating spermatids of rat testes.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Chen HY, Sun JM, Zhang Y, Davie JR, Meistrich ML", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "reference": [ { "type": "PubMed", "id": "9582357", "url": "https://glygen.org/publication/PubMed/9582357" } ] } ], "pathway": [ { "id": "rno:291159", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291159", "resource": "KEGG Pathway" }, { "id": "rno:679994", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:679994", "resource": "KEGG Pathway" }, { "id": "R-RNO-1266695", "name": "Interleukin-7 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1266695", "resource": "Reactome", "description": "Interleukin-7 signaling" }, { "id": "R-RNO-201722", "name": "Formation of the beta-catenin:TCF transactivating complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-201722", "resource": "Reactome", "description": "Formation of the beta-catenin:TCF transactivating complex" }, { "id": "R-RNO-212300", "name": "PRC2 methylates histones and DNA", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-212300", "resource": "Reactome", "description": "PRC2 methylates histones and DNA" }, { "id": "R-RNO-2299718", "name": "Condensation of Prophase Chromosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2299718", "resource": "Reactome", "description": "Condensation of Prophase Chromosomes" }, { "id": "R-RNO-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-RNO-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-RNO-3214841", "name": "PKMTs methylate histone lysines", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214841", "resource": "Reactome", "description": "PKMTs methylate histone lysines" }, { "id": "R-RNO-3214842", "name": "HDMs demethylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214842", "resource": "Reactome", "description": "HDMs demethylate histones" }, { "id": "R-RNO-3214847", "name": "HATs acetylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214847", "resource": "Reactome", "description": "HATs acetylate histones" }, { "id": "R-RNO-3214858", "name": "RMTs methylate histone arginines", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-RNO-3247509", "name": "Chromatin modifying enzymes", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3247509", "resource": "Reactome", "description": "Chromatin modifying enzymes" }, { "id": "R-RNO-427359", "name": "SIRT1 negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427359", "resource": "Reactome", "description": "SIRT1 negatively regulates rRNA expression" }, { "id": "R-RNO-427413", "name": "NoRC negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427413", "resource": "Reactome", "description": "NoRC negatively regulates rRNA expression" }, { "id": "R-RNO-5250924", "name": "B-WICH complex positively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5250924", "resource": "Reactome", "description": "B-WICH complex positively regulates rRNA expression" }, { "id": "R-RNO-5578749", "name": "Transcriptional regulation by small RNAs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5578749", "resource": "Reactome", "description": "Transcriptional regulation by small RNAs" }, { "id": "R-RNO-5625886", "name": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5625886", "resource": "Reactome", "description": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3" }, { "id": "R-RNO-68616", "name": "Assembly of the ORC complex at the origin of replication", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68616", "resource": "Reactome", "description": "Assembly of the ORC complex at the origin of replication" }, { "id": "R-RNO-73728", "name": "RNA Polymerase I Promoter Opening", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73728", "resource": "Reactome", "description": "RNA Polymerase I Promoter Opening" }, { "id": "R-RNO-73772", "name": "RNA Polymerase I Promoter Escape", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-73772", "resource": "Reactome", "description": "RNA Polymerase I Promoter Escape" }, { "id": "R-RNO-8936459", "name": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8936459", "resource": "Reactome", "description": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function" }, { "id": "R-RNO-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-RNO-983231", "name": "Factors involved in megakaryocyte development and platelet production", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" } ], "orthologs": [ { "uniprot_canonical_ac": "P02299-1", "protein_name": "Histone H3", "gene_name": "His3:CG33848", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "45230950", "url": "http://www.informatics.jax.org/homology/45230950", "database": "MGI" }, { "id": "45230949", "url": "http://www.informatics.jax.org/homology/45230949", "database": "MGI" }, { "id": "45230948", "url": "http://www.informatics.jax.org/homology/45230948", "database": "MGI" }, { "id": "45230947", "url": "http://www.informatics.jax.org/homology/45230947", "database": "MGI" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P68433-1", "protein_name": "Histone H3.1", "gene_name": "H3c10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "45230950", "url": "http://www.informatics.jax.org/homology/45230950", "database": "MGI" }, { "id": "45230949", "url": "http://www.informatics.jax.org/homology/45230949", "database": "MGI" }, { "id": "45230948", "url": "http://www.informatics.jax.org/homology/45230948", "database": "MGI" }, { "id": "45230947", "url": "http://www.informatics.jax.org/homology/45230947", "database": "MGI" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" }, { "id": "Q6LED0", "url": "https://omabrowser.org/oma/group/Q6LED0/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Acetylation is generally linked to gene activation. Acetylation on Lys-10 (H3K9ac) impairs methylation at Arg-9 (H3R8me2s). Acetylation on Lys-19 (H3K18ac) and Lys-24 (H3K24ac) favors methylation at Arg-18 (H3R17me). Acetylation at Lys-123 (H3K122ac) by EP300/p300 plays a central role in chromatin structure: localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Asymmetric dimethylation at Arg-18 (H3R17me2a) by CARM1 is linked to gene activation. Symmetric dimethylation at Arg-9 (H3R8me2s) by PRMT5 is linked to gene repression. Asymmetric dimethylation at Arg-3 (H3R2me2a) by PRMT6 is linked to gene repression and is mutually exclusive with H3 Lys-5 methylation (H3K4me2 and H3K4me3). H3R2me2a is present at the 3' of genes regardless of their transcription state and is enriched on inactive promoters, while it is absent on active promoters.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Butyrylation of histones marks active promoters and competes with histone acetylation. It is present during late spermatogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68433", "url": "https://glygen.org/publication/PubMed/P68433" } ] }, { "annotation": "Citrullination at Arg-9 (H3R8ci) and/or Arg-18 (H3R17ci) by PADI4 impairs methylation and represses transcription.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Dopaminylated by TGM2 at Gln-6 (H3Q5dop) in ventral tegmental area (VTA) neurons (PubMed:32273471). H3Q5dop mediates neurotransmission-independent role of nuclear dopamine by regulating relapse-related transcriptional plasticity in the reward system (PubMed:32273471).", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "32273471", "url": "https://glygen.org/publication/PubMed/32273471" } ] }, { "annotation": "Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Lysine deamination at Lys-5 (H3K4all) to form allysine is mediated by LOXL2. Allysine formation by LOXL2 only takes place on H3K4me3 and results in gene repression.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Methylation at Lys-5 (H3K4me), Lys-37 (H3K36me) and Lys-80 (H3K79me) are linked to gene activation. Methylation at Lys-5 (H3K4me) facilitates subsequent acetylation of H3 and H4. Methylation at Lys-80 (H3K79me) is associated with DNA double-strand break (DSB) responses and is a specific target for TP53BP1. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are linked to gene repression. Methylation at Lys-10 (H3K9me) is a specific target for HP1 proteins (CBX1, CBX3 and CBX5) and prevents subsequent phosphorylation at Ser-11 (H3S10ph) and acetylation of H3 and H4. Methylation at Lys-5 (H3K4me) and Lys-80 (H3K79me) require preliminary monoubiquitination of H2B at 'Lys-120'. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are enriched in inactive X chromosome chromatin. Monomethylation at Lys-57 (H3K56me1) by EHMT2/G9A in G1 phase promotes interaction with PCNA and is required for DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Phosphorylated at Thr-4 (H3T3ph) by HASPIN during prophase and dephosphorylated during anaphase. Phosphorylation at Ser-11 (H3S10ph) by AURKB is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. In addition phosphorylation at Ser-11 (H3S10ph) by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-fos and c-jun. Phosphorylation at Ser-11 (H3S10ph), which is linked to gene activation, prevents methylation at Lys-10 (H3K9me) but facilitates acetylation of H3 and H4. Phosphorylation at Ser-11 (H3S10ph) by AURKB mediates the dissociation of HP1 proteins (CBX1, CBX3 and CBX5) from heterochromatin. Phosphorylation at Ser-11 (H3S10ph) is also an essential regulatory mechanism for neoplastic cell transformation. Phosphorylated at Ser-29 (H3S28ph) by MAP3K20 isoform 1, RPS6KA5 or AURKB during mitosis or upon ultraviolet B irradiation. Phosphorylation at Thr-7 (H3T6ph) by PRKCB is a specific tag for epigenetic transcriptional activation that prevents demethylation of Lys-5 (H3K4me) by LSD1/KDM1A. At centromeres, specifically phosphorylated at Thr-12 (H3T11ph) from prophase to early anaphase, by DAPK3 and PKN1. Phosphorylation at Thr-12 (H3T11ph) by PKN1 or isoform M2 of PKM (PKM2) is a specific tag for epigenetic transcriptional activation that promotes demethylation of Lys-10 (H3K9me) by KDM4C/JMJD2C. Phosphorylation at Thr-12 (H3T11ph) by chromatin-associated CHEK1 regulates the transcription of cell cycle regulatory genes by modulating acetylation of Lys-10 (H3K9ac). Phosphorylation at Tyr-42 (H3Y41ph) by JAK2 promotes exclusion of CBX5 (HP1 alpha) from chromatin.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Serine ADP-ribosylation by PARP1 or PARP2 constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage. Serine ADP-ribosylation at Ser-11 (H3S10ADPr) promotes recruitment of CHD1L. H3S10ADPr is mutually exclusive with phosphorylation at Ser-11 (H3S10ph) and impairs acetylation at Lys-10 (H3K9ac).", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Serotonylated by TGM2 at Gln-6 (H3Q5ser) during serotonergic neuron differentiation (By similarity). H3Q5ser is associated with trimethylation of Lys-5 (H3K4me3) and enhances general transcription factor IID (TFIID) complex-binding to H3K4me3, thereby facilitating transcription (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Succinylation at Lys-80 (H3K79succ) by KAT2A takes place with a maximum frequency around the transcription start sites of genes. It gives a specific tag for epigenetic transcription activation. Desuccinylation at Lys-123 (H3K122succ) by SIRT7 in response to DNA damage promotes chromatin condensation and double-strand breaks (DSBs) repair.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "P68431", "url": "https://glygen.org/publication/PubMed/P68431" } ] }, { "annotation": "Ubiquitinated by the CUL4-DDB-RBX1 complex in response to ultraviolet irradiation. This may weaken the interaction between histones and DNA and facilitate DNA accessibility to repair proteins. Monoubiquitinated by RAG1 in lymphoid cells, monoubiquitination is required for V(D)J recombination (By similarity). Ubiquitinated in testes.", "evidence": [ { "database": "UniProtKB", "id": "Q6LED0", "url": "https://www.uniprot.org/uniprot/Q6LED0" }, { "database": "PubMed", "id": "9582357", "url": "https://glygen.org/publication/PubMed/9582357" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }