{
    "uniprot_canonical_ac": "Q6IN01-1",
    "uniprot_ac": "Q6IN01",
    "uniprot_id": "PPR3B_RAT",
    "mass": {
        "chemical_mass": 32626.0,
        "monoisotopic_mass": 32626.0
    },
    "refseq": {
        "ac": "NP_620267",
        "name": "protein phosphatase 1 regulatory subunit 3B",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267"
    },
    "gene_names": [
        {
            "name": "Ppp1r3b",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q6IN01",
            "id": "Q6IN01"
        },
        {
            "name": "Ppp1r3b",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267",
            "id": "NP_620267"
        },
        {
            "name": "Ppp1r4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q6IN01",
            "id": "Q6IN01"
        }
    ],
    "protein_names": [
        {
            "name": "Protein phosphatase 1 regulatory subunit 3B",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "33 kDa glycogen-binding protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "PP1 subunit R4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "Protein phosphatase 1 regulatory subunit 4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "Protein phosphatase 1 subunit GL",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q6IN01"
        },
        {
            "name": "R4; 33 kDa glycogen-binding protein; protein phosphatase 1 subunit GL; protein phosphatase 1 regulatory subunit 4; hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL; PP1 subunit R4; protein phosphatase 1 (GL-subunit); protein phosphatase 1, regulatory (inhibitor) subunit 3B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267",
            "id": "NP_620267"
        },
        {
            "name": "protein phosphatase 1 regulatory subunit 3B",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267",
            "id": "NP_620267"
        }
    ],
    "function": [
        {
            "annotation": "Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01#function"
                },
                {
                    "database": "PubMed",
                    "id": "10862764",
                    "url": "https://glygen.org/publication/PubMed/10862764"
                },
                {
                    "database": "PubMed",
                    "id": "17555403",
                    "url": "https://glygen.org/publication/PubMed/17555403"
                },
                {
                    "database": "PubMed",
                    "id": "7498521",
                    "url": "https://glygen.org/publication/PubMed/7498521"
                }
            ]
        },
        {
            "annotation": "Data show that inhibition of the interaction between protein phosphatase 1 glycogen-targeting subunit and glycogen phosphorylase increases glycogen synthesis in primary rat hepatocytes.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_620267",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267"
                },
                {
                    "database": "PubMed",
                    "id": "18298402",
                    "url": "https://glygen.org/publication/PubMed/18298402"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:1574",
            "recommended_name": {
                "id": "DOID:1574",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:1574",
                "name": "alcohol use disorder",
                "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences."
            },
            "synonyms": [
                {
                    "id": "DOID:1574",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:1574",
                    "name": "Ethanol abuse",
                    "description": ""
                },
                {
                    "id": "DOID:1574",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:1574",
                    "name": "alcohol abuse",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "1574",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:1574"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "Ppp1r3b",
            "url": "https://www.uniprot.org/uniprot/Q6IN01",
            "locus": {
                "chromosome": "16",
                "start_pos": 56829660,
                "end_pos": 56842406,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000011474",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000011474"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSRNOG00000011474",
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000011474",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "CBM21",
            "url": "http://www.cazy.org/CBM21.html",
            "database": "CAZy",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd22814",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22814",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "192280",
            "url": "https://www.ncbi.nlm.nih.gov/gene/192280",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q6IN01",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6IN01*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR005036",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR005036",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017434",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017434",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR030682",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR030682",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR038175",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR038175",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:192280",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:192280",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "YRIIQAE",
            "url": "https://omabrowser.org/oma/group/YRIIQAE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "3059370at2759",
            "url": "http://www.orthodb.org/?query=3059370at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12307",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12307",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12307:SF13",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12307:SF13",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF03370",
            "url": "http://pfam.xfam.org/family/PF03370",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q6IN01",
            "url": "http://purl.obolibrary.org/obo/PR_Q6IN01",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_620267",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "621600",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621600",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q6IN01",
            "url": "https://www.uniprot.org/uniprot/Q6IN01",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q6IN01-1",
            "url": "https://www.uniprot.org/uniprot/Q6IN01-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAVDIEYSYSSMAPSLRRERFTFKISPKLNKPLRPCIQLGSKDEAGRMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQSYWDSNKGKNYRITRAELRSTQGMTEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY",
        "length": 284,
        "header": "sp|Q6IN01-1|PPR3B_RAT Isoform 1 of Protein phosphatase 1 regulatory subunit 3B  OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1 CANONICAL=Q6IN01-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q6IN01-1",
            "url": "",
            "sequence": {
                "sequence": "MAVDIEYSYSSMAPSLRRERFTFKISPKLNKPLRPCIQLGSKDEAGRMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQSYWDSNKGKNYRITRAELRSTQGMTEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY",
                "length": 284,
                "header": "sp|Q6IN01-1|PPR3B_RAT Isoform 1 of Protein phosphatase 1 regulatory subunit 3B  OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1 CANONICAL=Q6IN01-1"
            },
            "locus": {
                "chromosome": "16",
                "start_pos": 56834152,
                "end_pos": 56833301,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000051720",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000051720"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000042713",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000042713"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 260,
            "end_pos": 260,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "site_lbl": "Ser260"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Distinctive regulatory and metabolic properties of glycogen-targeting subunits of protein phosphatase-1 (PTG, GL, GM/RGl) expressed in hepatocytes.",
            "journal": "J. Biol. Chem.",
            "date": "2000",
            "authors": "Jensen P.B., DePaoli-Roach A.A., Newgard C.B., Gasa R., Berman H.K., Brady M.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10862764",
                    "url": "https://glygen.org/publication/PubMed/10862764"
                }
            ]
        },
        {
            "title": "Human skeletal muscle expresses a glycogen-targeting subunit of PP1 that is identical to the insulin-sensitive glycogen-targeting subunit G(L) of liver.",
            "journal": "Diabetes",
            "date": "2002",
            "authors": "Munro S, Cuthbertson DJ, Cunningham J, Sales M, Cohen PT",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11872655",
                    "url": "https://glygen.org/publication/PubMed/11872655"
                }
            ]
        },
        {
            "title": "Expression and glycogenic effect of glycogen-targeting protein phosphatase 1 regulatory subunit GL in cultured human muscle.",
            "journal": "Biochem. J.",
            "date": "2007",
            "authors": "Montori-Grau M, Guitart M, Lerin C, Andreu AL, Newgard CB, Garcia-Martinez C, Gomez-Foix AM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17555403",
                    "url": "https://glygen.org/publication/PubMed/17555403"
                }
            ]
        },
        {
            "title": "Inhibition of the interaction between protein phosphatase 1 glycogen-targeting subunit and glycogen phosphorylase increases glycogen synthesis in primary rat hepatocytes.",
            "journal": "The Biochemical journal",
            "date": "2008",
            "authors": "Zibrova D, Grempler R, Streicher R, Kauschke SG",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_620267",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_620267"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18298402",
                    "url": "https://glygen.org/publication/PubMed/18298402"
                }
            ]
        },
        {
            "title": "Amino acid sequence and expression of the hepatic glycogen-binding (GL)-subunit of protein phosphatase-1.",
            "journal": "FEBS Lett.",
            "date": "1995",
            "authors": "Doherty MJ, Moorhead G, Morrice N, Cohen P, Cohen PT",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7498521",
                    "url": "https://glygen.org/publication/PubMed/7498521"
                }
            ]
        },
        {
            "title": "Purification of the hepatic glycogen-associated form of protein phosphatase-1 by microcystin-Sepharose affinity chromatography.",
            "journal": "FEBS Lett.",
            "date": "1995",
            "authors": "Moorhead G, MacKintosh C, Morrice N, Cohen P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7720853",
                    "url": "https://glygen.org/publication/PubMed/7720853"
                }
            ]
        },
        {
            "title": "Identification of the separate domains in the hepatic glycogen-targeting subunit of protein phosphatase 1 that interact with phosphorylase a, glycogen and protein phosphatase 1.",
            "journal": "Biochem. J.",
            "date": "1998",
            "authors": "Cohen P.T.W., Armstrong C.G., Doherty M.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q6IN01",
                    "url": "https://www.uniprot.org/uniprot/Q6IN01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9841883",
                    "url": "https://glygen.org/publication/PubMed/9841883"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:192280",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:192280",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q86XI6-1",
            "protein_name": "Protein phosphatase 1 regulatory subunit 3B",
            "gene_name": "PPP1R3B",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY",
                "length": 285
            },
            "evidence": [
                {
                    "id": "45236847",
                    "url": "http://www.informatics.jax.org/homology/45236847",
                    "database": "MGI"
                },
                {
                    "id": "Q6IN01",
                    "url": "https://omabrowser.org/oma/group/Q6IN01/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q8C767-1",
            "protein_name": "Protein phosphatase 1 regulatory subunit 3B",
            "gene_name": "Ppp1r3b",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWDSNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY",
                "length": 284
            },
            "evidence": [
                {
                    "id": "45236847",
                    "url": "http://www.informatics.jax.org/homology/45236847",
                    "database": "MGI"
                },
                {
                    "id": "Q6IN01",
                    "url": "https://omabrowser.org/oma/group/Q6IN01/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "protein phosphatase type 1 complex",
                        "id": "GO:0000164",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000164",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glycogen granule",
                        "id": "GO:0042587",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042587",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "regulation of glycogen catabolic process",
                        "id": "GO:0005981",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005981",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glycogen metabolic process",
                        "id": "GO:0005977",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005977",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of glycogen biosynthetic process",
                        "id": "GO:0005979",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005979",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 5,
                "go_terms": [
                    {
                        "name": "enzyme binding",
                        "id": "GO:0019899",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein phosphatase regulator activity",
                        "id": "GO:0019888",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019888",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein phosphatase 1 binding",
                        "id": "GO:0008157",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008157",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glycogen binding",
                        "id": "GO:2001069",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001069",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "[phosphorylase] phosphatase activity",
                        "id": "GO:0050196",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050196",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q6IN01",
                                "url": "https://www.uniprot.org/uniprot/Q6IN01"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 90,
            "end_pos": 92,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}