{ "uniprot_canonical_ac": "Q6IAA8-1", "uniprot_ac": "Q6IAA8", "uniprot_id": "LTOR1_HUMAN", "mass": { "chemical_mass": 17745.0, "monoisotopic_mass": 17745.0 }, "refseq": { "ac": "NP_060377", "name": "ragulator complex protein LAMTOR1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" }, "gene_names": [ { "name": "LAMTOR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "id": "Q6IAA8" }, { "name": "C11orf59; p18; p27RF-Rho; PDRO; Ragulator1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377", "id": "NP_060377" }, { "name": "C11orf59", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "id": "Q6IAA8" }, { "name": "LAMTOR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377", "id": "NP_060377" }, { "name": "PDRO", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "id": "Q6IAA8" }, { "name": "PP7157", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "id": "Q6IAA8" } ], "protein_names": [ { "name": "Ragulator complex protein LAMTOR1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6IAA8" }, { "name": "Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6IAA8" }, { "name": "Lipid raft adaptor protein p18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6IAA8" }, { "name": "Protein associated with DRMs and endosomes", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6IAA8" }, { "name": "p27Kip1-releasing factor from RhoA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6IAA8" }, { "name": "p27RF-Rho", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6IAA8" }, { "name": "p27kip1 releasing factor from RhoA; ragulator complex protein PDRO; protein associated with DRMs and endosomes; RhoA activator C11orf59; p27Kip1-releasing factor from RhoA; lipid raft adaptor protein p18; late endosomal/lysosomal adaptor and MAPK and MTOR activator 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377", "id": "NP_060377" }, { "name": "ragulator complex protein LAMTOR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377", "id": "NP_060377" } ], "function": [ { "annotation": "Key component of the Ragulator complex, a multiprotein complex involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:20381137, PubMed:22980980, PubMed:29158492). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane (PubMed:22980980, PubMed:30181260, PubMed:31001086, PubMed:32686708, PubMed:36476874, PubMed:29158492, PubMed:28935770). Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated (PubMed:20381137, PubMed:22980980, PubMed:29158492). LAMTOR1 is directly responsible for anchoring the Ragulator complex to the lysosomal membrane (PubMed:31001086, PubMed:32686708). LAMTOR1 wraps around the other subunits of the Ragulator complex to hold them in place and interacts with the Rag GTPases, thereby playing a key role in the recruitment of the mTORC1 complex to lysosomes (PubMed:29285400, PubMed:29107538, PubMed:29123114, PubMed:28935770). Also involved in the control of embryonic stem cells differentiation via non-canonical RagC/RRAGC and RagD/RRAGD activation: together with FLCN, it is necessary to recruit and activate RagC/RRAGC and RagD/RRAGD at the lysosomes, and to induce exit of embryonic stem cells from pluripotency via non-canonical, mTOR-independent TFE3 inactivation (By similarity). Also required for late endosomes/lysosomes biogenesis it may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes (PubMed:20381137, PubMed:22980980). May be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes (PubMed:20544018). May also play a role in RHOA activation (PubMed:19654316).", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8#function" }, { "database": "PubMed", "id": "22980980", "url": "https://glygen.org/publication/PubMed/22980980" }, { "database": "PubMed", "id": "20381137", "url": "https://glygen.org/publication/PubMed/20381137" }, { "database": "PubMed", "id": "20544018", "url": "https://glygen.org/publication/PubMed/20544018" }, { "database": "PubMed", "id": "19654316", "url": "https://glygen.org/publication/PubMed/19654316" }, { "database": "UniProtKB", "id": "Q9CQ22", "url": "https://www.uniprot.org/uniprot/Q9CQ22#function" }, { "database": "PubMed", "id": "36476874", "url": "https://glygen.org/publication/PubMed/36476874" }, { "database": "PubMed", "id": "32686708", "url": "https://glygen.org/publication/PubMed/32686708" }, { "database": "PubMed", "id": "30181260", "url": "https://glygen.org/publication/PubMed/30181260" }, { "database": "PubMed", "id": "31001086", "url": "https://glygen.org/publication/PubMed/31001086" }, { "database": "PubMed", "id": "29123114", "url": "https://glygen.org/publication/PubMed/29123114" }, { "database": "PubMed", "id": "29285400", "url": "https://glygen.org/publication/PubMed/29285400" }, { "database": "PubMed", "id": "29107538", "url": "https://glygen.org/publication/PubMed/29107538" }, { "database": "PubMed", "id": "28935770", "url": "https://glygen.org/publication/PubMed/28935770" }, { "database": "PubMed", "id": "29158492", "url": "https://glygen.org/publication/PubMed/29158492" } ] }, { "annotation": "LAMTOR1 degrades MHC-II via the endocytic in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" }, { "database": "PubMed", "id": "36070764", "url": "https://glygen.org/publication/PubMed/36070764" } ] }, { "annotation": "N-myristoyltransferase-1 deficiency blocks myristoylation of LAMTOR1 and inhibits bladder cancer progression.", "evidence": [ { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" }, { "database": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" } ] }, { "annotation": "Studies in rat and mice, identified the rat p18 protein as an endosomal membrane anchoring protein which interacts with MEK1 scaffold p14/MP1 and mobilizes them to late endosome.", "evidence": [ { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" }, { "database": "PubMed", "id": "19177150", "url": "https://glygen.org/publication/PubMed/19177150" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 119, "end_pos": 119, "sequence_org": "L", "sequence_mut": "R", "comment": "Impaired assembly of the Ragulator complex.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "29123114", "url": "https://glygen.org/publication/PubMed/29123114" } ] }, { "start_pos": 132, "end_pos": 132, "sequence_org": "V", "sequence_mut": "D", "comment": "Impaired assembly of the Ragulator complex.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "29123114", "url": "https://glygen.org/publication/PubMed/29123114" } ] }, { "start_pos": 148, "end_pos": 149, "sequence_org": "VD", "sequence_mut": "AA", "comment": "Impaired assembly of the Ragulator complex.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "28935770", "url": "https://glygen.org/publication/PubMed/28935770" } ] }, { "start_pos": 151, "end_pos": 153, "sequence_org": "KEE", "sequence_mut": "AAA", "comment": "Impaired recruiment of Rag GTPases (RRAGA and RRAGC) to the lysosomal membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "28935770", "url": "https://glygen.org/publication/PubMed/28935770" } ] }, { "start_pos": 154, "end_pos": 156, "sequence_org": "LVV", "sequence_mut": "AAA", "comment": "Impaired recruiment of Rag GTPases (RRAGA and RRAGC) to the lysosomal membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "28935770", "url": "https://glygen.org/publication/PubMed/28935770" } ] }, { "start_pos": 154, "end_pos": 158, "sequence_org": "LVVQF", "sequence_mut": "DDDQD", "comment": "Does not affect interaction with RRAGA and RRAGC in vitro.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "29285400", "url": "https://glygen.org/publication/PubMed/29285400" } ] }, { "start_pos": 2, "end_pos": 2, "sequence_org": "G", "sequence_mut": "A", "comment": "Abolished N-myristoylation and subsequent palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" } ] }, { "start_pos": 3, "end_pos": 3, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" } ] }, { "start_pos": 3, "end_pos": 3, "sequence_org": "C", "sequence_mut": "S", "comment": "Does not affect interaction with ZDHHC3.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "35893977", "url": "https://glygen.org/publication/PubMed/35893977" } ] }, { "start_pos": 3, "end_pos": 4, "sequence_org": "CC", "sequence_mut": "SS", "comment": "Abolished palmitoylation and recruitment to lysosomes, leading to impaired activation of the mTORC1 complex.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "35893977", "url": "https://glygen.org/publication/PubMed/35893977" }, { "database": "PubMed", "id": "31001086", "url": "https://glygen.org/publication/PubMed/31001086" } ] }, { "start_pos": 4, "end_pos": 4, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" } ] }, { "start_pos": 4, "end_pos": 4, "sequence_org": "C", "sequence_mut": "S", "comment": "Does not affect interaction with ZDHHC3.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "35893977", "url": "https://glygen.org/publication/PubMed/35893977" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "97.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q6IAA8", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q6IAA8" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "common_name": "Human" } ], "gene": [ { "name": "LAMTOR1", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "locus": { "chromosome": "11", "start_pos": 72085895, "end_pos": 72103297, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000149357", "url": "https://www.ensembl.org/id/ENSG00000149357" } ] } } ], "crossref": [ { "id": "ENSG00000149357", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000149357", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "LAMTOR1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LAMTOR1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "55004", "url": "https://www.ncbi.nlm.nih.gov/gene/55004", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26068", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26068", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "F5H479", "url": "https://www.ebi.ac.uk/intact/interactors/id:F5H479*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q6IAA8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q6IAA8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR028209", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028209", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:55004", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:55004", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "613510", "url": "http://www.omim.org/entry/613510", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q6IAA8", "url": "https://www.nextprot.org/entry/NX_Q6IAA8", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "HNLEQHE", "url": "https://omabrowser.org/oma/group/HNLEQHE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3666844at2759", "url": "http://www.orthodb.org/?query=3666844at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13401", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13401", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13401:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13401:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5X6U", "url": "https://www.rcsb.org/structure/5X6U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X6V", "url": "https://www.rcsb.org/structure/5X6V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y39", "url": "https://www.rcsb.org/structure/5Y39", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y3A", "url": "https://www.rcsb.org/structure/5Y3A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YK3", "url": "https://www.rcsb.org/structure/5YK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6B9X", "url": "https://www.rcsb.org/structure/6B9X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EHP", "url": "https://www.rcsb.org/structure/6EHP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EHR", "url": "https://www.rcsb.org/structure/6EHR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NZD", "url": "https://www.rcsb.org/structure/6NZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6U62", "url": "https://www.rcsb.org/structure/6U62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ULG", "url": "https://www.rcsb.org/structure/6ULG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WJ2", "url": "https://www.rcsb.org/structure/6WJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WJ3", "url": "https://www.rcsb.org/structure/6WJ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T3A", "url": "https://www.rcsb.org/structure/7T3A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T3B", "url": "https://www.rcsb.org/structure/7T3B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T3C", "url": "https://www.rcsb.org/structure/7T3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UX2", "url": "https://www.rcsb.org/structure/7UX2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UXC", "url": "https://www.rcsb.org/structure/7UXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UXH", "url": "https://www.rcsb.org/structure/7UXH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DHB", "url": "https://www.rcsb.org/structure/8DHB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF15454", "url": "http://pfam.xfam.org/family/PF15454", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q6IAA8", "url": "https://pharos.nih.gov/targets/Q6IAA8", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q6IAA8", "url": "http://purl.obolibrary.org/obo/PR_Q6IAA8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F5GX19", "url": "https://www.uniprot.org/uniprot/F5GX19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GX19-1", "url": "https://www.uniprot.org/uniprot/F5GX19-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H267", "url": "https://www.uniprot.org/uniprot/F5H267", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H267-1", "url": "https://www.uniprot.org/uniprot/F5H267-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H3Y3", "url": "https://www.uniprot.org/uniprot/F5H3Y3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H3Y3-1", "url": "https://www.uniprot.org/uniprot/F5H3Y3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H479", "url": "https://www.uniprot.org/uniprot/F5H479", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H479-1", "url": "https://www.uniprot.org/uniprot/F5H479-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YFI1", "url": "https://www.uniprot.org/uniprot/H0YFI1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YFI1-1", "url": "https://www.uniprot.org/uniprot/H0YFI1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6IAA8-1", "url": "https://www.uniprot.org/uniprot/Q6IAA8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP", "length": 161, "header": "sp|Q6IAA8-1|LTOR1_HUMAN Isoform 1 of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2 CANONICAL=Q6IAA8-1" }, "isoforms": [ { "isoform_ac": "F5GX19-1", "url": "", "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVQLFQSTPCSQ", "length": 142, "header": "tr|F5GX19-1|F5GX19_HUMAN Computationally mapped isoform of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=1 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72103224, "end_pos": 72086412, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545249.5", "url": "https://www.ensembl.org/id/ENST00000545249.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440738.1", "url": "https://www.ensembl.org/id/ENSP00000440738.1" } ] } }, { "isoform_ac": "F5H267-1", "url": "", "sequence": { "sequence": "MGCCWTLAAPLPKLSMEPSPTTTACLPLALMSRPCSLPSLPRQPATSLMCLLQTHRAWSSMSTWTVPGSTAPAWLC", "length": 76, "header": "tr|F5H267-1|LTOR1_HUMAN Computationally mapped isoform of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=1 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72103224, "end_pos": 72098399, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000535872.1", "url": "https://www.ensembl.org/id/ENST00000535872.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000439482.1", "url": "https://www.ensembl.org/id/ENSP00000439482.1" } ] } }, { "isoform_ac": "F5H3Y3-1", "url": "", "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVRHPSPAPAHPSHTAQGMAEGSPTLPQRR", "length": 160, "header": "tr|F5H3Y3-1|LTOR1_HUMAN Computationally mapped isoform of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=1 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72103224, "end_pos": 72098202, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000538404.1", "url": "https://www.ensembl.org/id/ENST00000538404.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000439011.1", "url": "https://www.ensembl.org/id/ENSP00000439011.1" } ] } }, { "isoform_ac": "F5H479-1", "url": "", "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYRHTGHHTEKEL", "length": 99, "header": "tr|F5H479-1|F5H479_HUMAN Computationally mapped isoform of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=1 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72103224, "end_pos": 72094747, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000535107.5", "url": "https://www.ensembl.org/id/ENST00000535107.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000445170.1", "url": "https://www.ensembl.org/id/ENSP00000445170.1" } ] } }, { "isoform_ac": "H0YFI1-1", "url": "", "sequence": { "sequence": "XDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYRSPG", "length": 79, "header": "tr|H0YFI1-1|H0YFI1_HUMAN Computationally mapped isoform of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=1 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72099258, "end_pos": 72097904, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000544594.5", "url": "https://www.ensembl.org/id/ENST00000544594.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000438717.1", "url": "https://www.ensembl.org/id/ENSP00000438717.1" } ] } }, { "isoform_ac": "Q6IAA8-1", "url": "", "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP", "length": 161, "header": "sp|Q6IAA8-1|LTOR1_HUMAN Isoform 1 of Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2 CANONICAL=Q6IAA8-1" }, "locus": { "chromosome": "11", "start_pos": 72103224, "end_pos": 72097825, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000278671.10", "url": "https://www.ensembl.org/id/ENST00000278671.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000278671.5", "url": "https://www.ensembl.org/id/ENSP00000278671.5" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr100" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "site_lbl": "Ser141" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "Q6IAA8", "url": "http://phospho.elm.eu.org/byAccession/Q6IAA8.html" } ], "site_lbl": "Ser26" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "Q6IAA8", "url": "http://phospho.elm.eu.org/byAccession/Q6IAA8.html" } ], "site_lbl": "Ser27" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "phospho.ELM", "id": "Q6IAA8", "url": "http://phospho.elm.eu.org/byAccession/Q6IAA8.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr40" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "site_lbl": "Ser42" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Ser56" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser98" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Expression, purification and crystallization of a BH domain from the GTPase regulatory protein associated with focal adhesion kinase.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1999", "authors": "Sheffield PJ, Derewenda U, Taylor J, Parsons TJ, Derewenda ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10232922", "url": "https://glygen.org/publication/PubMed/10232922" } ] }, { "title": "Importance of glucose-6-phosphate dehydrogenase activity in cell death.", "journal": "The American journal of physiology", "date": "1999", "authors": "Tian WN, Braunstein LD, Apse K, Pang J, Rose M, Tian X, Stanton RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "10329961", "url": "https://glygen.org/publication/PubMed/10329961" } ] }, { "title": "Association of frabin with the actin cytoskeleton is essential for microspike formation through activation of Cdc42 small G protein.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Umikawa M, Obaishi H, Nakanishi H, Satoh-Horikawa K, Takahashi K, Hotta I, Matsuura Y, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10464238", "url": "https://glygen.org/publication/PubMed/10464238" } ] }, { "title": "The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Joberty G, Perlungher RR, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10490598", "url": "https://glygen.org/publication/PubMed/10490598" } ] }, { "title": "Sema3A-induced growth-cone collapse is mediated by Rac1 amino acids 17-32.", "journal": "Current biology : CB", "date": "1999", "authors": "Vastrik I, Eickholt BJ, Walsh FS, Ridley A, Doherty P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10508610", "url": "https://glygen.org/publication/PubMed/10508610" } ] }, { "title": "Dependence of Dbl and Dbs transformation on MEK and NF-kappaB activation.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Whitehead IP, Lambert QT, Glaven JA, Abe K, Rossman KL, Mahon GM, Trzaskos JM, Kay R, Campbell SL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10523665", "url": "https://glygen.org/publication/PubMed/10523665" } ] }, { "title": "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Movilla N, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "10523675", "url": "https://glygen.org/publication/PubMed/10523675" } ] }, { "title": "Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member.", "journal": "FEBS letters", "date": "1999", "authors": "Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10526156", "url": "https://glygen.org/publication/PubMed/10526156" } ] }, { "title": "Identification and characterization of hPEM-2, a guanine nucleotide exchange factor specific for Cdc42.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Reid T, Bathoorn A, Ahmadian MR, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10559246", "url": "https://glygen.org/publication/PubMed/10559246" } ] }, { "title": "Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Tatsumoto T, Xie X, Blumenthal R, Okamoto I, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10579713", "url": "https://glygen.org/publication/PubMed/10579713" } ] }, { "title": "Endogenous, hyperactive Rac3 controls proliferation of breast cancer cells by a p21-activated kinase-dependent pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Mira JP, Benard V, Groffen J, Sanders LC, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "10618392", "url": "https://glygen.org/publication/PubMed/10618392" } ] }, { "title": "TrioGEF1 controls Rac- and Cdc42-dependent cell structures through the direct activation of rhoG.", "journal": "Journal of cell science", "date": "2000", "authors": "Blangy A, Vignal E, Schmidt S, Debant A, Gauthier-Rouviere C, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "10652265", "url": "https://glygen.org/publication/PubMed/10652265" } ] }, { "title": "Serum-stimulated, rapamycin-sensitive phosphorylation sites in the eukaryotic translation initiation factor 4GI.", "journal": "The EMBO journal", "date": "2000-02-01", "authors": "Raught B, Gingras A C, Gygi S P, Imataka H, Morino S, Gradi A, Aebersold R, Sonenberg N", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "10654941", "url": "https://glygen.org/publication/PubMed/10654941" } ] }, { "title": "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.", "journal": "Human molecular genetics", "date": "2000", "authors": "Prakash SK, Paylor R, Jenna S, Lamarche-Vane N, Armstrong DL, Xu B, Mancini MA, Zoghbi HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10699171", "url": "https://glygen.org/publication/PubMed/10699171" } ] }, { "title": "Molecular cloning and characterization of a novel human STE20-like kinase, hSLK.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Yamada E, Tsujikawa K, Itoh S, Kameda Y, Kohama Y, Yamamoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10699464", "url": "https://glygen.org/publication/PubMed/10699464" } ] }, { "title": "A ribonucleotide reductase gene involved in a p53-dependent cell-cycle checkpoint for DNA damage.", "journal": "Nature", "date": "2000", "authors": "Tanaka H, Arakawa H, Yamaguchi T, Shiraishi K, Fukuda S, Matsui K, Takei Y, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "10716435", "url": "https://glygen.org/publication/PubMed/10716435" } ] }, { "title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.", "journal": "Nature", "date": "2000", "authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "10724160", "url": "https://glygen.org/publication/PubMed/10724160" } ] }, { "title": "Human glucose-6-phosphate dehydrogenase: the crystal structure reveals a structural NADP(+) molecule and provides insights into enzyme deficiency.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Au SW, Gover S, Lam VM, Adams MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "10745013", "url": "https://glygen.org/publication/PubMed/10745013" } ] }, { "title": "Trio combines with dock to regulate Pak activity during photoreceptor axon pathfinding in Drosophila.", "journal": "Cell", "date": "2000", "authors": "Newsome TP, Schmidt S, Dietzl G, Keleman K, Asling B, Debant A, Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "10847683", "url": "https://glygen.org/publication/PubMed/10847683" } ] }, { "title": "A human homolog of the C. elegans polarity determinant Par-6 links Rac and Cdc42 to PKCzeta signaling and cell transformation.", "journal": "Current biology : CB", "date": "2000", "authors": "Qiu RG, Abo A, Steven Martin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10873802", "url": "https://glygen.org/publication/PubMed/10873802" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Characterization of TCL, a new GTPase of the rho family related to TC10 andCcdc42.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Vignal E, De Toledo M, Comunale F, Ladopoulou A, Gauthier-Rouviere C, Blangy A, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "10967094", "url": "https://glygen.org/publication/PubMed/10967094" } ] }, { "title": "A ribonucleotide reductase gene is a transcriptional target of p53 and p73.", "journal": "Oncogene", "date": "2000", "authors": "Nakano K, Balint E, Ashcroft M, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "10980602", "url": "https://glygen.org/publication/PubMed/10980602" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Isoform-specific and exercise intensity-dependent activation of 5'-AMP-activated protein kinase in human skeletal muscle.", "journal": "The Journal of physiology", "date": "2000", "authors": "Wojtaszewski JF, Nielsen P, Hansen BF, Richter EA, Kiens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "11018120", "url": "https://glygen.org/publication/PubMed/11018120" } ] }, { "title": "Overexpression of fructose 2,6-bisphosphatase decreases glycolysis and delays cell cycle progression.", "journal": "American journal of physiology. Cell physiology", "date": "2000", "authors": "Perez JX, Roig T, Manzano A, Dalmau M, Boada J, Ventura F, Rosa JL, Bermudez J, Bartrons R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11029283", "url": "https://glygen.org/publication/PubMed/11029283" } ] }, { "title": "Cells overexpressing fructose-2,6-bisphosphatase showed enhanced pentose phosphate pathway flux and resistance to oxidative stress.", "journal": "FEBS letters", "date": "2000", "authors": "Boada J, Roig T, Perez X, Gamez A, Bartrons R, Cascante M, Bermudez J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11034341", "url": "https://glygen.org/publication/PubMed/11034341" } ] }, { "title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11058585", "url": "https://glygen.org/publication/PubMed/11058585" } ] }, { "title": "Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor.", "journal": "The Biochemical journal", "date": "2000", "authors": "Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11085924", "url": "https://glygen.org/publication/PubMed/11085924" } ] }, { "title": "The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tanida I, Tanida-Miyake E, Ueno T, Kominami E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "11096062", "url": "https://glygen.org/publication/PubMed/11096062" } ] }, { "title": "Rac2 is an essential regulator of neutrophil nicotinamide adenine dinucleotide phosphate oxidase activation in response to specific signaling pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Kim C, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "11145705", "url": "https://glygen.org/publication/PubMed/11145705" } ] }, { "title": "Differential localization of Rho GTPases in live cells: regulation by hypervariable regions and RhoGDI binding.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Michaelson D, Silletti J, Murphy G, D'Eustachio P, Rush M, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11149925", "url": "https://glygen.org/publication/PubMed/11149925" } ] }, { "title": "Sequence analysis, gene expression, and chromosomal assignment of mouse Borg4 gene and its human orthologue.", "journal": "Journal of human genetics", "date": "2000", "authors": "Osada N, Kusuda J, Suzuki Y, Sugano S, Hashimoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "11185749", "url": "https://glygen.org/publication/PubMed/11185749" } ] }, { "title": "Signaling mediated by the closely related mammalian Rho family GTPases TC10 and Cdc42 suggests distinct functional pathways.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "2001", "authors": "Murphy GA, Jillian SA, Michaelson D, Philips MR, D'Eustachio P, Rush MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11306516", "url": "https://glygen.org/publication/PubMed/11306516" } ] }, { "title": "Structures and proton-pumping strategies of mitochondrial respiratory enzymes.", "journal": "Annual review of biophysics and biomolecular structure", "date": "2001", "authors": "Schultz BE, Chan SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11340051", "url": "https://glygen.org/publication/PubMed/11340051" } ] }, { "title": "Interactions between Rho GTPases and Rho GDP dissociation inhibitor (Rho-GDI).", "journal": "Biochimie", "date": "2001", "authors": "Faure J, Dagher MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "11368848", "url": "https://glygen.org/publication/PubMed/11368848" } ] }, { "title": "Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Reuther GW, Lambert QT, Booden MA, Wennerberg K, Becknell B, Marcucci G, Sondek J, Caligiuri MA, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11373293", "url": "https://glygen.org/publication/PubMed/11373293" } ] }, { "title": "Tumor suppressor and anti-inflammatory actions of PPARgamma agonists are mediated via upregulation of PTEN.", "journal": "Current biology : CB", "date": "2001", "authors": "Patel L, Pass I, Coxon P, Downes CP, Smith SA, Macphee CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11378386", "url": "https://glygen.org/publication/PubMed/11378386" } ] }, { "title": "Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Furukawa Y, Kawasoe T, Daigo Y, Nishiwaki T, Ishiguro H, Takahashi M, Kitayama J, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11396949", "url": "https://glygen.org/publication/PubMed/11396949" } ] }, { "title": "Rich, a rho GTPase-activating protein domain-containing protein involved in signaling by Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Richnau N, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11431473", "url": "https://glygen.org/publication/PubMed/11431473" } ] }, { "title": "PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.", "journal": "Journal of biochemistry", "date": "2001", "authors": "Shibata H, Oishi K, Yamagiwa A, Matsumoto M, Mukai H, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11432776", "url": "https://glygen.org/publication/PubMed/11432776" } ] }, { "title": "Growth factors can influence cell growth and survival through effects on glucose metabolism.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Vander Heiden MG, Plas DR, Rathmell JC, Fox CJ, Harris MH, Thompson CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11486029", "url": "https://glygen.org/publication/PubMed/11486029" } ] }, { "title": "Regulation of PTEN transcription by p53.", "journal": "Molecular cell", "date": "2001", "authors": "Stambolic V, MacPherson D, Sas D, Lin Y, Snow B, Jang Y, Benchimol S, Mak TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11545734", "url": "https://glygen.org/publication/PubMed/11545734" } ] }, { "title": "Endocytic protein intersectin-l regulates actin assembly via Cdc42 and N-WASP.", "journal": "Nature cell biology", "date": "2001", "authors": "Hussain NK, Jenna S, Glogauer M, Quinn CC, Wasiak S, Guipponi M, Antonarakis SE, Kay BK, Stossel TP, Lamarche-Vane N, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11584276", "url": "https://glygen.org/publication/PubMed/11584276" } ] }, { "title": "Distinct roles for the two Rho GDP/GTP exchange factor domains of kalirin in regulation of neurite growth and neuronal morphology.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Penzes P, Johnson RC, Kambampati V, Mains RE, Eipper BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11606631", "url": "https://glygen.org/publication/PubMed/11606631" } ] }, { "title": "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.", "journal": "Cell", "date": "2001", "authors": "Wong K, Ren XR, Huang YZ, Xie Y, Liu G, Saito H, Tang H, Wen L, Brady-Kalnay SM, Mei L, Wu JY, Xiong WC, Rao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11672528", "url": "https://glygen.org/publication/PubMed/11672528" } ] }, { "title": "Kinectin is a key effector of RhoG microtubule-dependent cellular activity.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Vignal E, Blangy A, Martin M, Gauthier-Rouviere C, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11689693", "url": "https://glygen.org/publication/PubMed/11689693" } ] }, { "title": "Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex.", "journal": "Current biology : CB", "date": "2001", "authors": "Krugmann S, Jordens I, Gevaert K, Driessens M, Vandekerckhove J, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11696321", "url": "https://glygen.org/publication/PubMed/11696321" } ] }, { "title": "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3.", "journal": "Oncogene", "date": "2001", "authors": "De Toledo M, Coulon V, Schmidt S, Fort P, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11704860", "url": "https://glygen.org/publication/PubMed/11704860" } ] }, { "title": "Characterization of STEF, a guanine nucleotide exchange factor for Rac1, required for neurite growth.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuo N, Hoshino M, Yoshizawa M, Nabeshima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11707441", "url": "https://glygen.org/publication/PubMed/11707441" } ] }, { "title": "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Dan C, Nath N, Liberto M, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11756552", "url": "https://glygen.org/publication/PubMed/11756552" } ] }, { "title": "AR and ER interaction with a p21-activated kinase (PAK6).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Lee SR, Ramos SM, Ko A, Masiello D, Swanson KD, Lu ML, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11773441", "url": "https://glygen.org/publication/PubMed/11773441" } ] }, { "title": "The Egr-1 transcription factor directly activates PTEN during irradiation-induced signalling.", "journal": "Nature cell biology", "date": "2001", "authors": "Virolle T, Adamson ED, Baron V, Birle D, Mercola D, Mustelin T, de Belle I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "11781575", "url": "https://glygen.org/publication/PubMed/11781575" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.", "journal": "Molecular cell", "date": "2002", "authors": "Krugmann S, Anderson KE, Ridley SH, Risso N, McGregor A, Coadwell J, Davidson K, Eguinoa A, Ellson CD, Lipp P, Manifava M, Ktistakis N, Painter G, Thuring JW, Cooper MA, Lim ZY, Holmes AB, Dove SK, Michell RH, Grewal A, Nazarian A, Erdjument-Bromage H, Tempst P, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804589", "url": "https://glygen.org/publication/PubMed/11804589" } ] }, { "title": "ARAP1: a point of convergence for Arf and Rho signaling.", "journal": "Molecular cell", "date": "2002", "authors": "Miura K, Jacques KM, Stauffer S, Kubosaki A, Zhu K, Hirsch DS, Resau J, Zheng Y, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804590", "url": "https://glygen.org/publication/PubMed/11804590" } ] }, { "title": "The hematopoiesis-specific GTP-binding protein RhoH is GTPase deficient and modulates activities of other Rho GTPases by an inhibitory function.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Li X, Bu X, Lu B, Avraham H, Flavell RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "11809807", "url": "https://glygen.org/publication/PubMed/11809807" } ] }, { "title": "Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Tanida I, Tanida-Miyake E, Komatsu M, Ueno T, Kominami E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "11825910", "url": "https://glygen.org/publication/PubMed/11825910" } ] }, { "title": "The Human Rho-GEF trio and its target GTPase RhoG are involved in the NGF pathway, leading to neurite outgrowth.", "journal": "Current biology : CB", "date": "2002", "authors": "Estrach S, Schmidt S, Diriong S, Penna A, Blangy A, Fort P, Debant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11864571", "url": "https://glygen.org/publication/PubMed/11864571" } ] }, { "title": "Distinct role of phosphatidylinositol 3-kinase and Rho family GTPases in Vav3-induced cell transformation, cell motility, and morphological changes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sachdev P, Zeng L, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11884391", "url": "https://glygen.org/publication/PubMed/11884391" } ] }, { "title": "Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.", "journal": "Nature cell biology", "date": "2002", "authors": "Krendel M, Zenke FT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11912491", "url": "https://glygen.org/publication/PubMed/11912491" } ] }, { "title": "Rac function and regulation during Drosophila development.", "journal": "Nature", "date": "2002", "authors": "Hakeda-Suzuki S, Ng J, Tzu J, Dietzl G, Sun Y, Harms M, Nardine T, Luo L, Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "11919634", "url": "https://glygen.org/publication/PubMed/11919634" } ] }, { "title": "IQGAP1 is a component of Cdc42 signaling to the cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Swart-Mataraza JM, Li Z, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11948177", "url": "https://glygen.org/publication/PubMed/11948177" } ] }, { "title": "Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain.", "journal": "International journal of molecular medicine", "date": "2002", "authors": "De Langhe S, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "11956649", "url": "https://glygen.org/publication/PubMed/11956649" } ] }, { "title": "p53 regulates cell survival by inhibiting PIK3CA in squamous cell carcinomas.", "journal": "Genes & development", "date": "2002", "authors": "Singh B, Reddy PG, Goberdhan A, Walsh C, Dao S, Ngai I, Chou TC, O-Charoenrat P, Levine AJ, Rao PH, Stoffel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "11959846", "url": "https://glygen.org/publication/PubMed/11959846" } ] }, { "title": "SWAP-70 is a guanine-nucleotide-exchange factor that mediates signalling of membrane ruffling.", "journal": "Nature", "date": "2002", "authors": "Shinohara M, Terada Y, Iwamatsu A, Shinohara A, Mochizuki N, Higuchi M, Gotoh Y, Ihara S, Nagata S, Itoh H, Fukui Y, Jessberger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11961559", "url": "https://glygen.org/publication/PubMed/11961559" } ] }, { "title": "RhoGDI-3 regulates RhoG and targets this protein to the Golgi complex through its unique N-terminal domain.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Brunet N, Morin A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11967128", "url": "https://glygen.org/publication/PubMed/11967128" } ] }, { "title": "A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.", "journal": "The Biochemical journal", "date": "2002", "authors": "Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12071859", "url": "https://glygen.org/publication/PubMed/12071859" } ] }, { "title": "A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.", "journal": "The Biochemical journal", "date": "2002", "authors": "Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12093360", "url": "https://glygen.org/publication/PubMed/12093360" } ] }, { "title": "p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr.", "journal": "Oncogene", "date": "2002", "authors": "Korus M, Mahon GM, Cheng L, Whitehead IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12096337", "url": "https://glygen.org/publication/PubMed/12096337" } ] }, { "title": "Raptor, a binding partner of target of rapamycin (TOR), mediates TOR action.", "journal": "Cell", "date": "2002", "authors": "Hara K, Maruki Y, Long X, Yoshino K, Oshiro N, Hidayat S, Tokunaga C, Avruch J, Yonezawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "12150926", "url": "https://glygen.org/publication/PubMed/12150926" } ] }, { "title": "Phosphoprotein analysis using antibodies broadly reactive against phosphorylated motifs.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Zhang H, Zha X, Tan Y, Hornbeck PV, Mastrangelo AJ, Alessi DR, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "12151408", "url": "https://glygen.org/publication/PubMed/12151408" } ] }, { "title": "Inactivation of human peroxiredoxin I during catalysis as the result of the oxidation of the catalytic site cysteine to cysteine-sulfinic acid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Yang KS, Kang SW, Woo HA, Hwang SC, Chae HZ, Kim K, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12161445", "url": "https://glygen.org/publication/PubMed/12161445" } ] }, { "title": "Zizimin1, a novel Cdc42 activator, reveals a new GEF domain for Rho proteins.", "journal": "Nature cell biology", "date": "2002", "authors": "Meller N, Irani-Tehrani M, Kiosses WB, Del Pozo MA, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12172552", "url": "https://glygen.org/publication/PubMed/12172552" } ] }, { "title": "Kalirin Dbl-homology guanine nucleotide exchange factor 1 domain initiates new axon outgrowths via RhoG-mediated mechanisms.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "May V, Schiller MR, Eipper BA, Mains RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "12177196", "url": "https://glygen.org/publication/PubMed/12177196" } ] }, { "title": "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Endris V, Wogatzky B, Leimer U, Bartsch D, Zatyka M, Latif F, Maher ER, Tariverdian G, Kirsch S, Karch D, Rappold GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12195014", "url": "https://glygen.org/publication/PubMed/12195014" } ] }, { "title": "Identification of a novel stress-responsive gene Hi95 involved in regulation of cell viability.", "journal": "Oncogene", "date": "2002", "authors": "Budanov AV, Shoshani T, Faerman A, Zelin E, Kamer I, Kalinski H, Gorodin S, Fishman A, Chajut A, Einat P, Skaliter R, Gudkov AV, Chumakov PM, Feinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12203114", "url": "https://glygen.org/publication/PubMed/12203114" } ] }, { "title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12221096", "url": "https://glygen.org/publication/PubMed/12221096" } ] }, { "title": "The TC10-interacting protein CIP4/2 is required for insulin-stimulated Glut4 translocation in 3T3L1 adipocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chang L, Adams RD, Saltiel AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "12242347", "url": "https://glygen.org/publication/PubMed/12242347" } ] }, { "title": "A novel FERM domain including guanine nucleotide exchange factor is involved in Rac signaling and regulates neurite remodeling.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Kubo T, Yamashita T, Yamaguchi A, Sumimoto H, Hosokawa K, Tohyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12351724", "url": "https://glygen.org/publication/PubMed/12351724" } ] }, { "title": "RhoG signals in parallel with Rac1 and Cdc42.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wennerberg K, Ellerbroek SM, Liu RY, Karnoub AE, Burridge K, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "12376551", "url": "https://glygen.org/publication/PubMed/12376551" } ] }, { "title": "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.", "journal": "Journal of cell science", "date": "2002", "authors": "Cote JF, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12432077", "url": "https://glygen.org/publication/PubMed/12432077" } ] }, { "title": "14-3-3 interacts with the tumor suppressor tuberin at Akt phosphorylation site(s).", "journal": "Cancer research", "date": "2002", "authors": "Liu MY, Cai S, Espejo A, Bedford MT, Walker CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12438239", "url": "https://glygen.org/publication/PubMed/12438239" } ] }, { "title": "REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species.", "journal": "Molecular cell", "date": "2002", "authors": "Ellisen LW, Ramsayer KD, Johannessen CM, Yang A, Beppu H, Minda K, Oliner JD, McKeon F, Haber DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12453409", "url": "https://glygen.org/publication/PubMed/12453409" } ] }, { "title": "Small GTPase Tc10 and its homologue RhoT induce N-WASP-mediated long process formation and neurite outgrowth.", "journal": "Journal of cell science", "date": "2003", "authors": "Abe T, Kato M, Miki H, Takenawa T, Endo T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "12456725", "url": "https://glygen.org/publication/PubMed/12456725" } ] }, { "title": "A new constitutively active brain PAK3 isoform displays modified specificities toward Rac and Cdc42 GTPases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Rousseau V, Goupille O, Morin N, Barnier JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12464619", "url": "https://glygen.org/publication/PubMed/12464619" } ] }, { "title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.", "journal": "Circulation research", "date": "2002", "authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12480817", "url": "https://glygen.org/publication/PubMed/12480817" } ] }, { "title": "Identification of a proline-rich Akt substrate as a 14-3-3 binding partner.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kovacina KS, Park GY, Bae SS, Guzzetta AW, Schaefer E, Birnbaum MJ, Roth RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "12524439", "url": "https://glygen.org/publication/PubMed/12524439" } ] }, { "title": "Deleted in liver cancer (DLC) 2 encodes a RhoGAP protein with growth suppressor function and is underexpressed in hepatocellular carcinoma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ching YP, Wong CM, Chan SF, Leung TH, Ng DC, Jin DY, Ng IO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12531887", "url": "https://glygen.org/publication/PubMed/12531887" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "A Rac/Cdc42-specific exchange factor, GEFT, induces cell proliferation, transformation, and migration.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Guo X, Stafford LJ, Bryan B, Xia C, Ma W, Wu X, Liu D, Songyang Z, Liu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12547822", "url": "https://glygen.org/publication/PubMed/12547822" } ] }, { "title": "ArhGAP15, a novel human RacGAP protein with GTPase binding property.", "journal": "FEBS letters", "date": "2003", "authors": "Seoh ML, Ng CH, Yong J, Lim L, Leung T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12650940", "url": "https://glygen.org/publication/PubMed/12650940" } ] }, { "title": "Translocation of CrkL to focal adhesions mediates integrin-induced migration downstream of Src family kinases.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Li L, Guris DL, Okura M, Imamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12665586", "url": "https://glygen.org/publication/PubMed/12665586" } ] }, { "title": "Peroxiredoxin evolution and the regulation of hydrogen peroxide signaling.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Wood ZA, Poole LB, Karplus PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12714747", "url": "https://glygen.org/publication/PubMed/12714747" } ] }, { "title": "Sirolimus: its discovery, biological properties, and mechanism of action.", "journal": "Transplantation proceedings", "date": "2003", "authors": "Sehgal SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "12742462", "url": "https://glygen.org/publication/PubMed/12742462" } ] }, { "title": "TCGAP, a multidomain Rho GTPase-activating protein involved in insulin-stimulated glucose transport.", "journal": "The EMBO journal", "date": "2003", "authors": "Chiang SH, Hwang J, Legendre M, Zhang M, Kimura A, Saltiel AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12773384", "url": "https://glygen.org/publication/PubMed/12773384" } ] }, { "title": "Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD.", "journal": "The EMBO journal", "date": "2003", "authors": "Baas AF, Boudeau J, Sapkota GP, Smit L, Medema R, Morrice NA, Alessi DR, Clevers HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "12805220", "url": "https://glygen.org/publication/PubMed/12805220" } ] }, { "title": "p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12857875", "url": "https://glygen.org/publication/PubMed/12857875" } ] }, { "title": "Identification of an autoinhibitory domain of p21-activated protein kinase 5.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ching YP, Leong VY, Wong CM, Kung HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12860998", "url": "https://glygen.org/publication/PubMed/12860998" } ] }, { "title": "Rheb GTPase is a direct target of TSC2 GAP activity and regulates mTOR signaling.", "journal": "Genes & development", "date": "2003", "authors": "Inoki K, Li Y, Xu T, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12869586", "url": "https://glygen.org/publication/PubMed/12869586" } ] }, { "title": "Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.", "journal": "The Biochemical journal", "date": "2003", "authors": "Caloca MJ, Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12877655", "url": "https://glygen.org/publication/PubMed/12877655" } ] }, { "title": "Tuberous sclerosis complex gene products, Tuberin and Hamartin, control mTOR signaling by acting as a GTPase-activating protein complex toward Rheb.", "journal": "Current biology : CB", "date": "2003", "authors": "Tee AR, Manning BD, Roux PP, Cantley LC, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "12906785", "url": "https://glygen.org/publication/PubMed/12906785" } ] }, { "title": "The mechanism of p21-activated kinase 2 autoactivation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu H, Wang ZX", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12907671", "url": "https://glygen.org/publication/PubMed/12907671" } ] }, { "title": "T cell receptor engagement leads to the recruitment of IBP, a novel guanine nucleotide exchange factor, to the immunological synapse.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gupta S, Fanzo JC, Hu C, Cox D, Jang SY, Lee AE, Greenberg S, Pernis AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12923183", "url": "https://glygen.org/publication/PubMed/12923183" } ] }, { "title": "On the origin of cancer cells.", "journal": "Science (New York, N.Y.)", "date": "1956", "authors": "WARBURG O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "13298683", "url": "https://glygen.org/publication/PubMed/13298683" } ] }, { "title": "Enzymes of the human erythrocyte. IV. Phosphoglucose isomerase, purification and properties.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "TSUBOI KK, ESTRADA J, HUDSON PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "13538944", "url": "https://glygen.org/publication/PubMed/13538944" } ] }, { "title": "Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Salazar MA, Kwiatkowski AV, Pellegrini L, Cestra G, Butler MH, Rossman KL, Serna DM, Sondek J, Gertler FB, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "14506234", "url": "https://glygen.org/publication/PubMed/14506234" } ] }, { "title": "Complexes between the LKB1 tumor suppressor, STRAD alpha/beta and MO25 alpha/beta are upstream kinases in the AMP-activated protein kinase cascade.", "journal": "Journal of biology", "date": "2003", "authors": "Hawley SA, Boudeau J, Reid JL, Mustard KJ, Udd L, Makela TP, Alessi DR, Hardie DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "14511394", "url": "https://glygen.org/publication/PubMed/14511394" } ] }, { "title": "G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.", "journal": "Circulation research", "date": "2003", "authors": "Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14512443", "url": "https://glygen.org/publication/PubMed/14512443" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm.", "journal": "The EMBO journal", "date": "2003", "authors": "Boudeau J, Baas AF, Deak M, Morrice NA, Kieloch A, Schutkowski M, Prescott AR, Clevers HC, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "14517248", "url": "https://glygen.org/publication/PubMed/14517248" } ] }, { "title": "LKB1 is the upstream kinase in the AMP-activated protein kinase cascade.", "journal": "Current biology : CB", "date": "2003", "authors": "Woods A, Johnstone SR, Dickerson K, Leiper FC, Fryer LG, Neumann D, Schlattner U, Wallimann T, Carlson M, Carling D", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "14614828", "url": "https://glygen.org/publication/PubMed/14614828" } ] }, { "title": "Post-translational processing of rac p21s is important both for their interaction with the GDP/GTP exchange proteins and for their activation of NADPH oxidase.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ando S, Kaibuchi K, Sasaki T, Hiraoka K, Nishiyama T, Mizuno T, Asada M, Nunoi H, Matsuda I, Matsuura Y, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "1464587", "url": "https://glygen.org/publication/PubMed/1464587" } ] }, { "title": "TSC2 mediates cellular energy response to control cell growth and survival.", "journal": "Cell", "date": "2003", "authors": "Inoki K, Zhu T, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "14651849", "url": "https://glygen.org/publication/PubMed/14651849" } ] }, { "title": "Comparative functional analysis of the Rac GTPases.", "journal": "FEBS letters", "date": "2003", "authors": "Haeusler LC, Blumenstein L, Stege P, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14675773", "url": "https://glygen.org/publication/PubMed/14675773" } ] }, { "title": "MOCA induces membrane spreading by activating Rac1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Namekata K, Enokido Y, Iwasawa K, Kimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14718541", "url": "https://glygen.org/publication/PubMed/14718541" } ] }, { "title": "The tumor suppressor LKB1 kinase directly activates AMP-activated kinase and regulates apoptosis in response to energy stress.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Shaw RJ, Kosmatka M, Bardeesy N, Hurley RL, Witters LA, DePinho RA, Cantley LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "14985505", "url": "https://glygen.org/publication/PubMed/14985505" } ] }, { "title": "DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.", "journal": "Experimental cell research", "date": "2004", "authors": "Mavrakis KJ, McKinlay KJ, Jones P, Sablitzky F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15023524", "url": "https://glygen.org/publication/PubMed/15023524" } ] }, { "title": "Alsin is a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Topp JD, Gray NW, Gerard RD, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15033976", "url": "https://glygen.org/publication/PubMed/15033976" } ] }, { "title": "Glucose-6-phosphate dehydrogenase plays a crucial role in protection from redox-stress-induced apoptosis.", "journal": "Cell death and differentiation", "date": "2004", "authors": "Fico A, Paglialunga F, Cigliano L, Abrescia P, Verde P, Martini G, Iaccarino I, Filosa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "15044966", "url": "https://glygen.org/publication/PubMed/15044966" } ] }, { "title": "BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Lua BL, Low BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15064355", "url": "https://glygen.org/publication/PubMed/15064355" } ] }, { "title": "Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Budanov AV, Sablina AA, Feinstein E, Koonin EV, Chumakov PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "15105503", "url": "https://glygen.org/publication/PubMed/15105503" } ] }, { "title": "Scambio, a novel guanine nucleotide exchange factor for Rho.", "journal": "Molecular cancer", "date": "2004", "authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15107133", "url": "https://glygen.org/publication/PubMed/15107133" } ] }, { "title": "SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Ellerbroek SM, Wennerberg K, Arthur WT, Dunty JM, Bowman DR, DeMali KA, Der C, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "15133129", "url": "https://glygen.org/publication/PubMed/15133129" } ] }, { "title": "Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.", "journal": "FEBS letters", "date": "2004", "authors": "Sakakibara T, Nemoto Y, Nukiwa T, Takeshima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15147912", "url": "https://glygen.org/publication/PubMed/15147912" } ] }, { "title": "Role of the Sec14-like domain of Dbl family exchange factors in the regulation of Rho family GTPases in different subcellular sites.", "journal": "Cellular signalling", "date": "2004", "authors": "Ueda S, Kataoka T, Satoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15157669", "url": "https://glygen.org/publication/PubMed/15157669" } ] }, { "title": "Cdc42, Rac1, and Rac2 display distinct patterns of activation during phagocytosis.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Hoppe AD, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15169870", "url": "https://glygen.org/publication/PubMed/15169870" } ] }, { "title": "HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tanida I, Sou YS, Ezaki J, Minematsu-Ikeguchi N, Ueno T, Kominami E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "15187094", "url": "https://glygen.org/publication/PubMed/15187094" } ] }, { "title": "Proton pump coupled to cytochrome c oxidase in mitochondria.", "journal": "Nature", "date": "1977", "authors": "Wikstrom MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "15223", "url": "https://glygen.org/publication/PubMed/15223" } ] }, { "title": "Toca-1 mediates Cdc42-dependent actin nucleation by activating the N-WASP-WIP complex.", "journal": "Cell", "date": "2004", "authors": "Ho HY, Rohatgi R, Lebensohn AM, Le Ma, Li J, Gygi SP, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15260990", "url": "https://glygen.org/publication/PubMed/15260990" } ] }, { "title": "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Su ZJ, Hahn CN, Goodall GJ, Reck NM, Leske AF, Davy A, Kremmidiotis G, Vadas MA, Gamble JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15302923", "url": "https://glygen.org/publication/PubMed/15302923" } ] }, { "title": "Isolation and characterisation of DOCK8, a member of the DOCK180-related regulators of cell morphology.", "journal": "FEBS letters", "date": "2004", "authors": "Ruusala A, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15304341", "url": "https://glygen.org/publication/PubMed/15304341" } ] }, { "title": "Upstream and downstream of mTOR.", "journal": "Genes & development", "date": "2004", "authors": "Hay N, Sonenberg N", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "15314020", "url": "https://glygen.org/publication/PubMed/15314020" } ] }, { "title": "Galpha13 stimulates cell migration through cortactin-interacting protein Hax-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Radhika V, Onesime D, Ha JH, Dhanasekaran N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15339924", "url": "https://glygen.org/publication/PubMed/15339924" } ] }, { "title": "Vilse, a conserved Rac/Cdc42 GAP mediating Robo repulsion in tracheal cells and axons.", "journal": "Genes & development", "date": "2004", "authors": "Lundstrom A, Gallio M, Englund C, Steneberg P, Hemphala J, Aspenstrom P, Keleman K, Falileeva L, Dickson BJ, Samakovlis C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15342493", "url": "https://glygen.org/publication/PubMed/15342493" } ] }, { "title": "WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Wang Y, Suzuki H, Yokoo T, Tada-Iida K, Kihara R, Miura M, Watanabe K, Sone H, Shimano H, Toyoshima H, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15485661", "url": "https://glygen.org/publication/PubMed/15485661" } ] }, { "title": "Large-scale cDNA transfection screening for genes related to cancer development and progression.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "15498874", "url": "https://glygen.org/publication/PubMed/15498874" } ] }, { "title": "Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.", "journal": "Cell", "date": "2004", "authors": "Canagarajah B, Leskow FC, Ho JY, Mischak H, Saidi LF, Kazanietz MG, Hurley JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15507211", "url": "https://glygen.org/publication/PubMed/15507211" } ] }, { "title": "SWAP-70 regulates c-kit-induced mast cell activation, cell-cell adhesion, and migration.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Sivalenka RR, Jessberger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15542837", "url": "https://glygen.org/publication/PubMed/15542837" } ] }, { "title": "Regulation of cystic fibrosis transmembrane regulator trafficking and protein expression by a Rho family small GTPase TC10.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Cheng J, Wang H, Guggino WB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "15546864", "url": "https://glygen.org/publication/PubMed/15546864" } ] }, { "title": "A Rac1/phosphatidylinositol 3-kinase/Akt3 anti-apoptotic pathway, triggered by AlsinLF, the product of the ALS2 gene, antagonizes Cu/Zn-superoxide dismutase (SOD1) mutant-induced motoneuronal cell death.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kanekura K, Hashimoto Y, Kita Y, Sasabe J, Aiso S, Nishimoto I, Matsuoka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15579468", "url": "https://glygen.org/publication/PubMed/15579468" } ] }, { "title": "Effect of phosphorylation by AMP-activated protein kinase on palmitoyl-CoA inhibition of skeletal muscle acetyl-CoA carboxylase.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2005", "authors": "Rubink DS, Winder WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "15579580", "url": "https://glygen.org/publication/PubMed/15579580" } ] }, { "title": "Signaling pathways: the benefits of good communication.", "journal": "Current biology : CB", "date": "2004", "authors": "Fisher TL, White MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "15589136", "url": "https://glygen.org/publication/PubMed/15589136" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "TIM, a Dbl-related protein, regulates cell shape and cytoskeletal organization in a Rho-dependent manner.", "journal": "Cellular signalling", "date": "2005", "authors": "Xie X, Chang SW, Tatsumoto T, Chan AM, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15601624", "url": "https://glygen.org/publication/PubMed/15601624" } ] }, { "title": "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lavelin I, Geiger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15611138", "url": "https://glygen.org/publication/PubMed/15611138" } ] }, { "title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.", "journal": "FEBS letters", "date": "2005", "authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "15710388", "url": "https://glygen.org/publication/PubMed/15710388" } ] }, { "title": "Local phosphatidylinositol 3,4,5-trisphosphate accumulation recruits Vav2 and Vav3 to activate Rac1/Cdc42 and initiate neurite outgrowth in nerve growth factor-stimulated PC12 cells.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Aoki K, Nakamura T, Fujikawa K, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15728722", "url": "https://glygen.org/publication/PubMed/15728722" } ] }, { "title": "Signaling by target of rapamycin proteins in cell growth control.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2005", "authors": "Inoki K, Ouyang H, Li Y, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "15755954", "url": "https://glygen.org/publication/PubMed/15755954" } ] }, { "title": "Structure of S6 kinase 1 determines whether raptor-mTOR or rictor-mTOR phosphorylates its hydrophobic motif site.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ali SM, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "15809305", "url": "https://glygen.org/publication/PubMed/15809305" } ] }, { "title": "Rac2 regulates neutrophil chemotaxis, superoxide production, and myeloid colony formation through multiple distinct effector pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Carstanjen D, Yamauchi A, Koornneef A, Zang H, Filippi MD, Harris C, Towe J, Atkinson S, Zheng Y, Dinauer MC, Williams DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15814684", "url": "https://glygen.org/publication/PubMed/15814684" } ] }, { "title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.", "journal": "Biochemistry", "date": "2005", "authors": "Heo J, Thapar R, Campbell SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15850391", "url": "https://glygen.org/publication/PubMed/15850391" } ] }, { "title": "Rheb binds and regulates the mTOR kinase.", "journal": "Current biology : CB", "date": "2005", "authors": "Long X, Lin Y, Ortiz-Vega S, Yonezawa K, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "15854902", "url": "https://glygen.org/publication/PubMed/15854902" } ] }, { "title": "Involvement of a Rac activator,P-Rex1, in neurotrophin-derived signaling and neuronal migration.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Yoshizawa M, Kawauchi T, Sone M, Nishimura YV, Terao M, Chihama K, Nabeshima Y, Hoshino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15858067", "url": "https://glygen.org/publication/PubMed/15858067" } ] }, { "title": "Rheb binding to mammalian target of rapamycin (mTOR) is regulated by amino acid sufficiency.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Long X, Ortiz-Vega S, Lin Y, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "15878852", "url": "https://glygen.org/publication/PubMed/15878852" } ] }, { "title": "Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Joseph RE, Norris FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15897194", "url": "https://glygen.org/publication/PubMed/15897194" } ] }, { "title": "Regulation of p21-activated kinase-independent Rac1 signal transduction by nischarin.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Reddig PJ, Xu D, Juliano RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16002401", "url": "https://glygen.org/publication/PubMed/16002401" } ] }, { "title": "Isoform-specific membrane targeting mechanism of Rac during Fc gamma R-mediated phagocytosis: positive charge-dependent and independent targeting mechanism of Rac to the phagosome.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Ueyama T, Eto M, Kami K, Tatsuno T, Kobayashi T, Shirai Y, Lennartz MR, Takeya R, Sumimoto H, Saito N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "16081809", "url": "https://glygen.org/publication/PubMed/16081809" } ] }, { "title": "Analysis of mTOR signaling by the small G-proteins, Rheb and RhebL1.", "journal": "FEBS letters", "date": "2005", "authors": "Tee AR, Blenis J, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "16098514", "url": "https://glygen.org/publication/PubMed/16098514" } ] }, { "title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Winkler S, Mohl M, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16112081", "url": "https://glygen.org/publication/PubMed/16112081" } ] }, { "title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.", "journal": "Nature genetics", "date": "2005", "authors": "Bauer H, Willert J, Koschorz B, Herrmann BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16116428", "url": "https://glygen.org/publication/PubMed/16116428" } ] }, { "title": "Identification of novel p53 target genes in ionizing radiation response.", "journal": "Cancer research", "date": "2005", "authors": "Jen KY, Cheung VG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16140933", "url": "https://glygen.org/publication/PubMed/16140933" } ] }, { "title": "ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion.", "journal": "Nature cell biology", "date": "2005", "authors": "Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16184169", "url": "https://glygen.org/publication/PubMed/16184169" } ] }, { "title": "Deleted in liver cancer 2 (DLC2) suppresses cell transformation by means of inhibition of RhoA activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Leung TH, Ching YP, Yam JW, Wong CM, Yau TO, Jin DY, Ng IO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "16217026", "url": "https://glygen.org/publication/PubMed/16217026" } ] }, { "title": "P-Rex1 regulates neutrophil function.", "journal": "Current biology : CB", "date": "2005", "authors": "Welch HC, Condliffe AM, Milne LJ, Ferguson GJ, Hill K, Webb LM, Okkenhaug K, Coadwell WJ, Andrews SR, Thelen M, Jones GE, Hawkins PT, Stephens LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "16243035", "url": "https://glygen.org/publication/PubMed/16243035" } ] }, { "title": "P-Rex1 is a primary Rac2 guanine nucleotide exchange factor in mouse neutrophils.", "journal": "Current biology : CB", "date": "2005", "authors": "Dong X, Mo Z, Bokoch G, Guo C, Li Z, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16243036", "url": "https://glygen.org/publication/PubMed/16243036" } ] }, { "title": "Activation of Rac1 by RhoG regulates cell migration.", "journal": "Journal of cell science", "date": "2006", "authors": "Katoh H, Hiramoto K, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "16339170", "url": "https://glygen.org/publication/PubMed/16339170" } ] }, { "title": "A global map of p53 transcription-factor binding sites in the human genome.", "journal": "Cell", "date": "2006", "authors": "Wei CL, Wu Q, Vega VB, Chiu KP, Ng P, Zhang T, Shahab A, Yong HC, Fu Y, Weng Z, Liu J, Zhao XD, Chew JL, Lee YL, Kuznetsov VA, Sung WK, Miller LD, Lim B, Liu ET, Yu Q, Ng HH, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16413492", "url": "https://glygen.org/publication/PubMed/16413492" } ] }, { "title": "Up-regulation of PTEN (phosphatase and tensin homolog deleted on chromosome ten) mediates p38 MAPK stress signal-induced inhibition of insulin signaling. A cross-talk between stress signaling and insulin signaling in resistin-treated human endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Shen YH, Zhang L, Gan Y, Wang X, Wang J, LeMaire SA, Coselli JS, Wang XL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16418168", "url": "https://glygen.org/publication/PubMed/16418168" } ] }, { "title": "Biochemical characterization of Alsin, a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "Methods in enzymology", "date": "2005", "authors": "Topp JD, Carney DS, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16473593", "url": "https://glygen.org/publication/PubMed/16473593" } ] }, { "title": "Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.", "journal": "The Journal of cell biology", "date": "2006", "authors": "ten Klooster JP, Jaffer ZM, Chernoff J, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16492808", "url": "https://glygen.org/publication/PubMed/16492808" } ] }, { "title": "Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ueyama T, Geiszt M, Leto TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16507994", "url": "https://glygen.org/publication/PubMed/16507994" } ] }, { "title": "The human orthologue of CdGAP is a phosphoprotein and a GTPase-activating protein for Cdc42 and Rac1 but not RhoA.", "journal": "Biology of the cell", "date": "2006", "authors": "Tcherkezian J, Triki I, Stenne R, Danek EI, Lamarche-Vane N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16519628", "url": "https://glygen.org/publication/PubMed/16519628" } ] }, { "title": "Regulation of phagocyte oxygen radical production by the GTP-binding protein Rac 2.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Knaus UG, Heyworth PG, Evans T, Curnutte JT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "1660188", "url": "https://glygen.org/publication/PubMed/1660188" } ] }, { "title": "The diaphanous-related formin DAAM1 collaborates with the Rho GTPases RhoA and Cdc42, CIP4 and Src in regulating cell morphogenesis and actin dynamics.", "journal": "Experimental cell research", "date": "2006", "authors": "Aspenstrom P, Richnau N, Johansson AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "16630611", "url": "https://glygen.org/publication/PubMed/16630611" } ] }, { "title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16636067", "url": "https://glygen.org/publication/PubMed/16636067" } ] }, { "title": "Activity of TSC2 is inhibited by AKT-mediated phosphorylation and membrane partitioning.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Cai SL, Tee AR, Short JD, Bergeron JM, Kim J, Shen J, Guo R, Johnson CL, Kiguchi K, Walker CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16636147", "url": "https://glygen.org/publication/PubMed/16636147" } ] }, { "title": "c-Jun promotes cellular survival by suppression of PTEN.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Hettinger K, Vikhanskaya F, Poh MK, Lee MK, de Belle I, Zhang JT, Reddy SA, Sabapathy K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16676006", "url": "https://glygen.org/publication/PubMed/16676006" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Nuclear receptor TLX prevents retinal dystrophy and recruits the corepressor atrophin1.", "journal": "Genes & development", "date": "2006", "authors": "Zhang CL, Zou Y, Yu RT, Gage FH, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "16702404", "url": "https://glygen.org/publication/PubMed/16702404" } ] }, { "title": "Caveolin-1 functions as a novel Cdc42 guanine nucleotide dissociation inhibitor in pancreatic beta-cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Nevins AK, Thurmond DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "16714282", "url": "https://glygen.org/publication/PubMed/16714282" } ] }, { "title": "p53 regulates mitochondrial respiration.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Matoba S, Kang JG, Patino WD, Wragg A, Boehm M, Gavrilova O, Hurley PJ, Bunz F, Hwang PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16728594", "url": "https://glygen.org/publication/PubMed/16728594" } ] }, { "title": "Assembly of mitochondrial cytochrome c-oxidase, a complicated and highly regulated cellular process.", "journal": "American journal of physiology. Cell physiology", "date": "2006", "authors": "Fontanesi F, Soto IC, Horn D, Barrientos A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16760263", "url": "https://glygen.org/publication/PubMed/16760263" } ] }, { "title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Miyano K, Ueno N, Takeya R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16762923", "url": "https://glygen.org/publication/PubMed/16762923" } ] }, { "title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.", "journal": "Molecular genetics and metabolism", "date": "2006", "authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16777452", "url": "https://glygen.org/publication/PubMed/16777452" } ] }, { "title": "Physical and functional interaction of Fyn tyrosine kinase with a brain-enriched Rho GTPase-activating protein TCGAP.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Liu H, Nakazawa T, Tezuka T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16777849", "url": "https://glygen.org/publication/PubMed/16777849" } ] }, { "title": "TIGAR, a p53-inducible regulator of glycolysis and apoptosis.", "journal": "Cell", "date": "2006", "authors": "Bensaad K, Tsuruta A, Selak MA, Vidal MN, Nakano K, Bartrons R, Gottlieb E, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "16839880", "url": "https://glygen.org/publication/PubMed/16839880" } ] }, { "title": "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.", "journal": "Nature cell biology", "date": "2006", "authors": "Ohta Y, Hartwig JH, Stossel TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16862148", "url": "https://glygen.org/publication/PubMed/16862148" } ] }, { "title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2006", "authors": "Mohl M, Winkler S, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16896804", "url": "https://glygen.org/publication/PubMed/16896804" } ] }, { "title": "Gene targeting of Cdc42 and Cdc42GAP affirms the critical involvement of Cdc42 in filopodia induction, directed migration, and proliferation in primary mouse embryonic fibroblasts.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Yang L, Wang L, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16914516", "url": "https://glygen.org/publication/PubMed/16914516" } ] }, { "title": "Dissecting the role of 5'-AMP for allosteric stimulation, activation, and deactivation of AMP-activated protein kinase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Suter M, Riek U, Tuerk R, Schlattner U, Wallimann T, Neumann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "16943194", "url": "https://glygen.org/publication/PubMed/16943194" } ] }, { "title": "Stimulation of ATG12-ATG5 conjugation by ribonucleic acid.", "journal": "Autophagy", "date": "2007", "authors": "Shao Y, Gao Z, Feldman T, Jiang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "16963840", "url": "https://glygen.org/publication/PubMed/16963840" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nat. Biotechnol.", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "H0YFI1", "url": "https://www.uniprot.org/uniprot/H0YFI1" }, { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "UniProtKB", "id": "F5GX19", "url": "https://www.uniprot.org/uniprot/F5GX19" }, { "database": "UniProtKB", "id": "F5H479", "url": "https://www.uniprot.org/uniprot/F5H479" }, { "database": "UniProtKB", "id": "F5H3Y3", "url": "https://www.uniprot.org/uniprot/F5H3Y3" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Identification of a DOCK180-related guanine nucleotide exchange factor that is capable of mediating a positive feedback activation of Cdc42.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lin Q, Yang W, Baird D, Feng Q, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16968698", "url": "https://glygen.org/publication/PubMed/16968698" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "RhoH GTPase recruits and activates Zap70 required for T cell receptor signaling and thymocyte development.", "journal": "Nature immunology", "date": "2006", "authors": "Gu Y, Chae HD, Siefring JE, Jasti AC, Hildeman DA, Williams DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "17028588", "url": "https://glygen.org/publication/PubMed/17028588" } ] }, { "title": "The Rac effector p67phox regulates phagocyte NADPH oxidase by stimulating Vav1 guanine nucleotide exchange activity.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Ming W, Li S, Billadeau DD, Quilliam LA, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17060455", "url": "https://glygen.org/publication/PubMed/17060455" } ] }, { "title": "Multiple Rho proteins regulate the subcellular targeting of PAK5.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Wu X, Frost JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "17064668", "url": "https://glygen.org/publication/PubMed/17064668" } ] }, { "title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.", "journal": "Journal of cell science", "date": "2006", "authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17077126", "url": "https://glygen.org/publication/PubMed/17077126" } ] }, { "title": "Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Hamann MJ, Lubking CM, Luchini DN, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17145773", "url": "https://glygen.org/publication/PubMed/17145773" } ] }, { "title": "Calcineurin is a common target of cyclophilin-cyclosporin A and FKBP-FK506 complexes.", "journal": "Cell", "date": "1991", "authors": "Liu J, Farmer JD Jr, Lane WS, Friedman J, Weissman I, Schreiber SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "1715244", "url": "https://glygen.org/publication/PubMed/1715244" } ] }, { "title": "Vav proteins control MyD88-dependent oxidative burst.", "journal": "Blood", "date": "2007", "authors": "Miletic AV, Graham DB, Montgrain V, Fujikawa K, Kloeppel T, Brim K, Weaver B, Schreiber R, Xavier R, Swat W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17158234", "url": "https://glygen.org/publication/PubMed/17158234" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "Asef is a Cdc42-specific guanine nucleotide exchange factor.", "journal": "Biological chemistry", "date": "2007", "authors": "Gotthardt K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "17214551", "url": "https://glygen.org/publication/PubMed/17214551" } ] }, { "title": "IQGAP3, a novel effector of Rac1 and Cdc42, regulates neurite outgrowth.", "journal": "Journal of cell science", "date": "2007", "authors": "Wang S, Watanabe T, Noritake J, Fukata M, Yoshimura T, Itoh N, Harada T, Nakagawa M, Matsuura Y, Arimura N, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17244649", "url": "https://glygen.org/publication/PubMed/17244649" } ] }, { "title": "Characterization of IQGAP1-containing complexes in NK-like cells: evidence for Rac 2 and RACK1 association during homotypic adhesion.", "journal": "Journal of proteome research", "date": "2007", "authors": "Meng X, Krokhin O, Cheng K, Ens W, Wilkins JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17269730", "url": "https://glygen.org/publication/PubMed/17269730" } ] }, { "title": "Insulin signalling to mTOR mediated by the Akt/PKB substrate PRAS40.", "journal": "Nature cell biology", "date": "2007", "authors": "Vander Haar E, Lee SI, Bandhakavi S, Griffin TJ, Kim DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "17277771", "url": "https://glygen.org/publication/PubMed/17277771" } ] }, { "title": "Biogenesis of eukaryotic cytochrome c oxidase.", "journal": "Physiological research", "date": "2006", "authors": "Stiburek L, Hansikova H, Tesarova M, Cerna L, Zeman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "17298220", "url": "https://glygen.org/publication/PubMed/17298220" } ] }, { "title": "PRAS40 is an insulin-regulated inhibitor of the mTORC1 protein kinase.", "journal": "Molecular cell", "date": "2007", "authors": "Sancak Y, Thoreen CC, Peterson TR, Lindquist RA, Kang SA, Spooner E, Carr SA, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "17386266", "url": "https://glygen.org/publication/PubMed/17386266" } ] }, { "title": "The Rheb switch 2 segment is critical for signaling to target of rapamycin complex 1.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Long X, Lin Y, Ortiz-Vega S, Busch S, Avruch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "17470430", "url": "https://glygen.org/publication/PubMed/17470430" } ] }, { "title": "Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion.", "journal": "Nature genetics", "date": "2007", "authors": "Bourdon A, Minai L, Serre V, Jais JP, Sarzi E, Aubert S, Chretien D, de Lonlay P, Paquis-Flucklinger V, Arakawa H, Nakamura Y, Munnich A, Rotig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "17486094", "url": "https://glygen.org/publication/PubMed/17486094" } ] }, { "title": "The proline-rich Akt substrate of 40 kDa (PRAS40) is a physiological substrate of mammalian target of rapamycin complex 1.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Oshiro N, Takahashi R, Yoshino K, Tanimura K, Nakashima A, Eguchi S, Miyamoto T, Hara K, Takehana K, Avruch J, Kikkawa U, Yonezawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "17517883", "url": "https://glygen.org/publication/PubMed/17517883" } ] }, { "title": "NGF-mediated transcriptional targets of p53 in PC12 neuronal differentiation.", "journal": "BMC genomics", "date": "2007", "authors": "Brynczka C, Labhart P, Merrick BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "17540029", "url": "https://glygen.org/publication/PubMed/17540029" } ] }, { "title": "Role of the small GTPase Rac in p22phox-dependent NADPH oxidases.", "journal": "Biochimie", "date": "2007", "authors": "Miyano K, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17583407", "url": "https://glygen.org/publication/PubMed/17583407" } ] }, { "title": "Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.", "journal": "Oncogene", "date": "2007", "authors": "Kawasaki Y, Sagara M, Shibata Y, Shirouzu M, Yokoyama S, Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17599059", "url": "https://glygen.org/publication/PubMed/17599059" } ] }, { "title": "Human WIPI-1 puncta-formation: a novel assay to assess mammalian autophagy.", "journal": "FEBS letters", "date": "2007", "authors": "Proikas-Cezanne T, Ruckerbauer S, Stierhof YD, Berg C, Nordheim A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "17618624", "url": "https://glygen.org/publication/PubMed/17618624" } ] }, { "title": "Membrane translocation of P-Rex1 is mediated by G protein betagamma subunits and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Barber MA, Donald S, Thelen S, Anderson KE, Thelen M, Welch HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17698854", "url": "https://glygen.org/publication/PubMed/17698854" } ] }, { "title": "Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Zhang Y, Sawada T, Jing X, Yokote H, Yan X, Sakaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17702745", "url": "https://glygen.org/publication/PubMed/17702745" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth.", "journal": "Molecular and cellular neurosciences", "date": "2007", "authors": "Vogt DL, Gray CD, Young WS 3rd, Orellana SA, Malouf AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17804252", "url": "https://glygen.org/publication/PubMed/17804252" } ] }, { "title": "Orphan nuclear receptor TLX recruits histone deacetylases to repress transcription and regulate neural stem cell proliferation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Sun G, Yu RT, Evans RM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17873065", "url": "https://glygen.org/publication/PubMed/17873065" } ] }, { "title": "DLC-1 suppresses non-small cell lung cancer growth and invasion by RhoGAP-dependent and independent mechanisms.", "journal": "Molecular carcinogenesis", "date": "2008", "authors": "Healy KD, Hodgson L, Kim TY, Shutes A, Maddileti S, Juliano RL, Hahn KM, Harden TK, Bang YJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "17932950", "url": "https://glygen.org/publication/PubMed/17932950" } ] }, { "title": "Suppression of PTEN expression is essential for antiapoptosis and cellular transformation by oncogenic Ras.", "journal": "Cancer research", "date": "2007", "authors": "Vasudevan KM, Burikhanov R, Goswami A, Rangnekar VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "17974977", "url": "https://glygen.org/publication/PubMed/17974977" } ] }, { "title": "START-GAP3/DLC3 is a GAP for RhoA and Cdc42 and is localized in focal adhesions regulating cell morphology.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Kawai K, Kiyota M, Seike J, Deki Y, Yagisawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17976533", "url": "https://glygen.org/publication/PubMed/17976533" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "Heterotrimeric G protein betagamma subunits stimulate FLJ00018, a guanine nucleotide exchange factor for Rac1 and Cdc42.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ueda H, Nagae R, Kozawa M, Morishita R, Kimura S, Nagase T, Ohara O, Yoshida S, Asano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18045877", "url": "https://glygen.org/publication/PubMed/18045877" } ] }, { "title": "Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kwofie MA, Skowronski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18056264", "url": "https://glygen.org/publication/PubMed/18056264" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Repression of PTEN phosphatase by Snail1 transcriptional factor during gamma radiation-induced apoptosis.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Escriva M, Peiro S, Herranz N, Villagrasa P, Dave N, Montserrat-Sentis B, Murray SA, Franci C, Gridley T, Virtanen I, Garcia de Herreros A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18172008", "url": "https://glygen.org/publication/PubMed/18172008" } ] }, { "title": "Activation of the small GTPase Rac2 via the B cell receptor regulates B cell adhesion and immunological-synapse formation.", "journal": "Immunity", "date": "2008", "authors": "Arana E, Vehlow A, Harwood NE, Vigorito E, Henderson R, Turner M, Tybulewicz VL, Batista FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "18191593", "url": "https://glygen.org/publication/PubMed/18191593" } ] }, { "title": "Hypoxia regulates TSC1/2-mTOR signaling and tumor suppression through REDD1-mediated 14-3-3 shuttling.", "journal": "Genes & development", "date": "2008", "authors": "DeYoung MP, Horak P, Sofer A, Sgroi D, Ellisen LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "18198340", "url": "https://glygen.org/publication/PubMed/18198340" } ] }, { "title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18218625", "url": "https://glygen.org/publication/PubMed/18218625" } ] }, { "title": "Role of chimaerins, a group of Rac-specific GTPase activating proteins, in T-cell receptor signaling.", "journal": "Cellular signalling", "date": "2008", "authors": "Caloca MJ, Delgado P, Alarcon B, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18249095", "url": "https://glygen.org/publication/PubMed/18249095" } ] }, { "title": "The Atg16L complex specifies the site of LC3 lipidation for membrane biogenesis in autophagy.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Fujita N, Itoh T, Omori H, Fukuda M, Noda T, Yoshimori T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "18321988", "url": "https://glygen.org/publication/PubMed/18321988" } ] }, { "title": "Synaptic NMDA receptor activity boosts intrinsic antioxidant defenses.", "journal": "Nature neuroscience", "date": "2008", "authors": "Papadia S, Soriano FX, Leveille F, Martel MA, Dakin KA, Hansen HH, Kaindl A, Sifringer M, Fowler J, Stefovska V, McKenzie G, Craigon M, Corriveau R, Ghazal P, Horsburgh K, Yankner BA, Wyllie DJ, Ikonomidou C, Hardingham GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "18344994", "url": "https://glygen.org/publication/PubMed/18344994" } ] }, { "title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18347018", "url": "https://glygen.org/publication/PubMed/18347018" } ] }, { "title": "Novel insights into FGD3, a putative GEF for Cdc42, that undergoes SCF(FWD1/beta-TrCP)-mediated proteasomal degradation analogous to that of its homologue FGD1 but regulates cell morphology and motility differently from FGD1.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2008", "authors": "Hayakawa M, Matsushima M, Hagiwara H, Oshima T, Fujino T, Ando K, Kikugawa K, Tanaka H, Miyazawa K, Kitagawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18363964", "url": "https://glygen.org/publication/PubMed/18363964" } ] }, { "title": "Regulation of proline-rich Akt substrate of 40 kDa (PRAS40) function by mammalian target of rapamycin complex 1 (mTORC1)-mediated phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wang L, Harris TE, Lawrence JC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "18372248", "url": "https://glygen.org/publication/PubMed/18372248" } ] }, { "title": "Transrepressive function of TLX requires the histone demethylase LSD1.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Yokoyama A, Takezawa S, Schule R, Kitagawa H, Kato S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18391013", "url": "https://glygen.org/publication/PubMed/18391013" } ] }, { "title": "Mutation of Dock5, a member of the guanine exchange factor Dock180 superfamily, in the rupture of lens cataract mouse.", "journal": "Experimental eye research", "date": "2008", "authors": "Omi N, Kiyokawa E, Matsuda M, Kinoshita K, Yamada S, Yamada K, Matsushima Y, Wang Y, Kawai J, Suzuki M, Hayashizaki Y, Hiai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18396277", "url": "https://glygen.org/publication/PubMed/18396277" } ] }, { "title": "ErbB2 directly activates the exchange factor Dock7 to promote Schwann cell migration.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Yamauchi J, Miyamoto Y, Chan JR, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18426980", "url": "https://glygen.org/publication/PubMed/18426980" } ] }, { "title": "AMPK phosphorylation of raptor mediates a metabolic checkpoint.", "journal": "Molecular cell", "date": "2008", "authors": "Gwinn DM, Shackelford DB, Egan DF, Mihaylova MM, Mery A, Vasquez DS, Turk BE, Shaw RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "18439900", "url": "https://glygen.org/publication/PubMed/18439900" } ] }, { "title": "SALL4 is a key regulator of survival and apoptosis in human leukemic cells.", "journal": "Blood", "date": "2008", "authors": "Yang J, Chai L, Gao C, Fowles TC, Alipio Z, Dang H, Xu D, Fink LM, Ward DC, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "18487508", "url": "https://glygen.org/publication/PubMed/18487508" } ] }, { "title": "The Rag GTPases bind raptor and mediate amino acid signaling to mTORC1.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Sancak Y, Peterson TR, Shaul YD, Lindquist RA, Thoreen CC, Bar-Peled L, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "18497260", "url": "https://glygen.org/publication/PubMed/18497260" } ] }, { "title": "Regulation of TORC1 by Rag GTPases in nutrient response.", "journal": "Nature cell biology", "date": "2008", "authors": "Kim E, Goraksha-Hicks P, Li L, Neufeld TP, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "18604198", "url": "https://glygen.org/publication/PubMed/18604198" } ] }, { "title": "Phosphorylation and activation of the Rac1 and Cdc42 GEF Asef in A431 cells stimulated by EGF.", "journal": "Journal of cell science", "date": "2008", "authors": "Itoh RE, Kiyokawa E, Aoki K, Nishioka T, Akiyama T, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18653540", "url": "https://glygen.org/publication/PubMed/18653540" } ] }, { "title": "Parallel phosphatidylinositol 3-kinase (PI3K)-dependent and Src-dependent pathways lead to CXCL8-mediated Rac2 activation and chemotaxis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sai J, Raman D, Liu Y, Wikswo J, Richmond A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "18662984", "url": "https://glygen.org/publication/PubMed/18662984" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "p53 target genes sestrin1 and sestrin2 connect genotoxic stress and mTOR signaling.", "journal": "Cell", "date": "2008", "authors": "Budanov AV, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "18692468", "url": "https://glygen.org/publication/PubMed/18692468" } ] }, { "title": "P-Rex1 - a multidomain protein that regulates neurite differentiation.", "journal": "Journal of cell science", "date": "2008", "authors": "Waters JE, Astle MV, Ooms LM, Balamatsias D, Gurung R, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "18697831", "url": "https://glygen.org/publication/PubMed/18697831" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Effects of structure of Rho GTPase-activating protein DLC-1 on cell morphology and migration.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kim TY, Healy KD, Der CJ, Sciaky N, Bang YJ, Juliano RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18786931", "url": "https://glygen.org/publication/PubMed/18786931" } ] }, { "title": "DOCK10-mediated Cdc42 activation is necessary for amoeboid invasion of melanoma cells.", "journal": "Current biology : CB", "date": "2008", "authors": "Gadea G, Sanz-Moreno V, Self A, Godi A, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18835169", "url": "https://glygen.org/publication/PubMed/18835169" } ] }, { "title": "FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Huber C, Martensson A, Bokoch GM, Nemazee D, Gavin AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18838382", "url": "https://glygen.org/publication/PubMed/18838382" } ] }, { "title": "Dissecting the thermodynamics of GAP-RhoA interactions.", "journal": "Journal of structural biology", "date": "2009", "authors": "Jelen F, Lachowicz P, Apostoluk W, Mateja A, Derewenda ZS, Otlewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18929667", "url": "https://glygen.org/publication/PubMed/18929667" } ] }, { "title": "Sestrin 2 is not a reductase for cysteine sulfinic acid of peroxiredoxins.", "journal": "Antioxidants & redox signaling", "date": "2009", "authors": "Woo HA, Bae SH, Park S, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "19113821", "url": "https://glygen.org/publication/PubMed/19113821" } ] }, { "title": "The novel lipid raft adaptor p18 controls endosome dynamics by anchoring the MEK-ERK pathway to late endosomes.", "journal": "The EMBO journal", "date": "2009", "authors": "Nada S, Hondo A, Kasai A, Koike M, Saito K, Uchiyama Y, Okada M", "evidence": [ { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" } ], "reference": [ { "type": "PubMed", "id": "19177150", "url": "https://glygen.org/publication/PubMed/19177150" } ] }, { "title": "Nutrient-dependent mTORC1 association with the ULK1-Atg13-FIP200 complex required for autophagy.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Hosokawa N, Hara T, Kaizuka T, Kishi C, Takamura A, Miura Y, Iemura S, Natsume T, Takehana K, Yamada N, Guan JL, Oshiro N, Mizushima N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "19211835", "url": "https://glygen.org/publication/PubMed/19211835" } ] }, { "title": "TC10 controls human myofibril organization and is activated by the sarcomeric RhoGEF obscurin.", "journal": "Journal of cell science", "date": "2009", "authors": "Coisy-Quivy M, Touzet O, Bourret A, Hipskind RA, Mercier J, Fort P, Philips A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "19258391", "url": "https://glygen.org/publication/PubMed/19258391" } ] }, { "title": "Silencing of D4-GDI inhibits growth and invasive behavior in MDA-MB-231 cells by activation of Rac-dependent p38 and JNK signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zhang Y, Rivera Rosado LA, Moon SY, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "19269969", "url": "https://glygen.org/publication/PubMed/19269969" } ] }, { "title": "The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.", "journal": "The EMBO journal", "date": "2009", "authors": "Satoo K, Noda NN, Kumeta H, Fujioka Y, Mizushima N, Ohsumi Y, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "19322194", "url": "https://glygen.org/publication/PubMed/19322194" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "p53 regulates mtDNA copy number and mitocheckpoint pathway.", "journal": "Journal of carcinogenesis", "date": "2009", "authors": "Kulawiec M, Ayyasamy V, Singh KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "19439913", "url": "https://glygen.org/publication/PubMed/19439913" } ] }, { "title": "Stem cell factor SALL4 represses the transcriptions of PTEN and SALL1 through an epigenetic repressor complex.", "journal": "PloS one", "date": "2009", "authors": "Lu J, Jeong HW, Kong N, Yang Y, Carroll J, Luo HR, Silberstein LE, Yupoma, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19440552", "url": "https://glygen.org/publication/PubMed/19440552" } ] }, { "title": "The PTEN-regulating microRNA miR-26a is amplified in high-grade glioma and facilitates gliomagenesis in vivo.", "journal": "Genes & development", "date": "2009", "authors": "Huse JT, Brennan C, Hambardzumyan D, Wee B, Pena J, Rouhanifard SH, Sohn-Lee C, le Sage C, Agami R, Tuschl T, Holland EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "19487573", "url": "https://glygen.org/publication/PubMed/19487573" } ] }, { "title": "Cdc42GAP, reactive oxygen species, and the vimentin network.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Li QF, Spinelli AM, Tang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19494238", "url": "https://glygen.org/publication/PubMed/19494238" } ] }, { "title": "The insert region of the Rac GTPases is dispensable for activation of superoxide-producing NADPH oxidases.", "journal": "The Biochemical journal", "date": "2009", "authors": "Miyano K, Koga H, Minakami R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "19534724", "url": "https://glygen.org/publication/PubMed/19534724" } ] }, { "title": "Suppression of RhoG activity is mediated by a syndecan 4-synectin-RhoGDI1 complex and is reversed by PKCalpha in a Rac1 activation pathway.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Elfenbein A, Rhodes JM, Meller J, Schwartz MA, Matsuda M, Simons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "19581409", "url": "https://glygen.org/publication/PubMed/19581409" } ] }, { "title": "Control of autophagy initiation by phosphoinositide 3-phosphatase Jumpy.", "journal": "The EMBO journal", "date": "2009", "authors": "Vergne I, Roberts E, Elmaoued RA, Tosch V, Delgado MA, Proikas-Cezanne T, Laporte J, Deretic V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "19590496", "url": "https://glygen.org/publication/PubMed/19590496" } ] }, { "title": "The rho-guanine nucleotide exchange factor domain of obscurin activates rhoA signaling in skeletal muscle.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Ford-Speelman DL, Roche JA, Bowman AL, Bloch RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19605563", "url": "https://glygen.org/publication/PubMed/19605563" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "A novel protein associated with membrane-type 1 matrix metalloproteinase binds p27(kip1) and regulates RhoA activation, actin remodeling, and matrigel invasion.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Nagano M., Seiki M., Hoshino D., Koshikawa N., Tomari T.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "19654316", "url": "https://glygen.org/publication/PubMed/19654316" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.", "journal": "Biochemistry", "date": "2009", "authors": "Levay M, Settleman J, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19673492", "url": "https://glygen.org/publication/PubMed/19673492" } ] }, { "title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "19713215", "url": "https://glygen.org/publication/PubMed/19713215" } ] }, { "title": "Role of sestrin2 in peroxide signaling in macrophages.", "journal": "FEBS letters", "date": "2009", "authors": "Essler S, Dehne N, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "19822145", "url": "https://glygen.org/publication/PubMed/19822145" } ] }, { "title": "3D tomography reveals connections between the phagophore and endoplasmic reticulum.", "journal": "Autophagy", "date": "2009", "authors": "Yla-Anttila P, Vihinen H, Jokitalo E, Eskelinen EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "19855179", "url": "https://glygen.org/publication/PubMed/19855179" } ] }, { "title": "The polycomb group protein Bmi-1 represses the tumor suppressor PTEN and induces epithelial-mesenchymal transition in human nasopharyngeal epithelial cells.", "journal": "The Journal of clinical investigation", "date": "2009", "authors": "Song LB, Li J, Liao WT, Feng Y, Yu CP, Hu LJ, Kong QL, Xu LH, Zhang X, Liu WL, Li MZ, Zhang L, Kang TB, Fu LW, Huang WL, Xia YF, Tsao SW, Li M, Band V, Band H, Shi QH, Zeng YX, Zeng MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "19884659", "url": "https://glygen.org/publication/PubMed/19884659" } ] }, { "title": "A subdomain of the endoplasmic reticulum forms a cradle for autophagosome formation.", "journal": "Nature cell biology", "date": "2009", "authors": "Hayashi-Nishino M, Fujita N, Noda T, Yamaguchi A, Yoshimori T, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "19898463", "url": "https://glygen.org/publication/PubMed/19898463" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.", "journal": "Journal of cell science", "date": "2009", "authors": "Bristow JM, Sellers MH, Majumdar D, Anderson B, Hu L, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19934221", "url": "https://glygen.org/publication/PubMed/19934221" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Modulation of local PtdIns3P levels by the PI phosphatase MTMR3 regulates constitutive autophagy.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Taguchi-Atarashi N, Hamasaki M, Matsunaga K, Omori H, Ktistakis NT, Yoshimori T, Noda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "20059746", "url": "https://glygen.org/publication/PubMed/20059746" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Integrative genome analysis reveals an oncomir/oncogene cluster regulating glioblastoma survivorship.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Kim H, Huang W, Jiang X, Pennicooke B, Park PJ, Johnson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "20080666", "url": "https://glygen.org/publication/PubMed/20080666" } ] }, { "title": "p53 regulation of the IGF-1/AKT/mTOR pathways and the endosomal compartment.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Feng Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "20182617", "url": "https://glygen.org/publication/PubMed/20182617" } ] }, { "title": "RhoH plays distinct roles in T-cell migrations induced by different doses of SDF1 alpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Wang H, Zeng X, Fan Z, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "20184954", "url": "https://glygen.org/publication/PubMed/20184954" } ] }, { "title": "Requirement of the mTOR kinase for the regulation of Maf1 phosphorylation and control of RNA polymerase III-dependent transcription in cancer cells.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Shor B, Wu J, Shakey Q, Toral-Barza L, Shi C, Follettie M, Yu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20233713", "url": "https://glygen.org/publication/PubMed/20233713" } ] }, { "title": "Phosphate-activated glutaminase (GLS2), a p53-inducible regulator of glutamine metabolism and reactive oxygen species.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Suzuki S, Tanaka T, Poyurovsky MV, Nagano H, Mayama T, Ohkubo S, Lokshin M, Hosokawa H, Nakayama T, Suzuki Y, Sugano S, Sato E, Nagao T, Yokote K, Tatsuno I, Prives C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "20351271", "url": "https://glygen.org/publication/PubMed/20351271" } ] }, { "title": "Glutaminase 2, a novel p53 target gene regulating energy metabolism and antioxidant function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Hu W, Zhang C, Wu R, Sun Y, Levine A, Feng Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "20378837", "url": "https://glygen.org/publication/PubMed/20378837" } ] }, { "title": "Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids.", "journal": "Cell", "date": "2010", "authors": "Sancak Y, Bar-Peled L, Zoncu R, Markhard AL, Nada S, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "20381137", "url": "https://glygen.org/publication/PubMed/20381137" } ] }, { "title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.", "journal": "Nature cell biology", "date": "2010", "authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20400958", "url": "https://glygen.org/publication/PubMed/20400958" } ] }, { "title": "Focal-adhesion targeting links caveolin-1 to a Rac1-degradation pathway.", "journal": "Journal of cell science", "date": "2010", "authors": "Nethe M, Anthony EC, Fernandez-Borja M, Dee R, Geerts D, Hensbergen PJ, Deelder AM, Schmidt G, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20460433", "url": "https://glygen.org/publication/PubMed/20460433" } ] }, { "title": "mTORC1 directly phosphorylates and regulates human MAF1.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Michels AA, Robitaille AM, Buczynski-Ruchonnet D, Hodroj W, Reina JH, Hall MN, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "20516213", "url": "https://glygen.org/publication/PubMed/20516213" } ] }, { "title": "Pdro, a protein associated with late endosomes and lysosomes and implicated in cellular cholesterol homeostasis.", "journal": "PLoS ONE", "date": "2010", "authors": "Guillaumot P, Luquain C, Malek M, Huber AL, Brugiere S, Garin J, Grunwald D, Regnier D, Petrilli V, Lefai E, Manie SN", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "20544018", "url": "https://glygen.org/publication/PubMed/20544018" } ] }, { "title": "Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Hiramoto-Yamaki N, Takeuchi S, Ueda S, Harada K, Fujimoto S, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "20679435", "url": "https://glygen.org/publication/PubMed/20679435" } ] }, { "title": "Autophagy requires endoplasmic reticulum targeting of the PI3-kinase complex via Atg14L.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Matsunaga K, Morita E, Saitoh T, Akira S, Ktistakis NT, Izumi T, Noda T, Yoshimori T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "20713597", "url": "https://glygen.org/publication/PubMed/20713597" } ] }, { "title": "srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Guo S, Bao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20810653", "url": "https://glygen.org/publication/PubMed/20810653" } ] }, { "title": "RhoH modulates pre-TCR and TCR signalling by regulating LCK.", "journal": "Cellular signalling", "date": "2011", "authors": "Wang H, Zeng X, Fan Z, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "20851766", "url": "https://glygen.org/publication/PubMed/20851766" } ] }, { "title": "The dynamic interaction of AMBRA1 with the dynein motor complex regulates mammalian autophagy.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Di Bartolomeo S, Corazzari M, Nazio F, Oliverio S, Lisi G, Antonioli M, Pagliarini V, Matteoni S, Fuoco C, Giunta L, D'Amelio M, Nardacci R, Romagnoli A, Piacentini M, Cecconi F, Fimia GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "20921139", "url": "https://glygen.org/publication/PubMed/20921139" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "The distinct role of guanine nucleotide exchange factor Vav1 in Bcl-2 transcription and apoptosis inhibition in Jurkat leukemia T cells.", "journal": "Acta pharmacologica Sinica", "date": "2011", "authors": "Yin J, Wan YJ, Li SY, Du MJ, Zhang CZ, Zhou XL, Cao YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "21151158", "url": "https://glygen.org/publication/PubMed/21151158" } ] }, { "title": "Kinetics comparisons of mammalian Atg4 homologues indicate selective preferences toward diverse Atg8 substrates.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Li M, Hou Y, Wang J, Chen X, Shao ZM, Yin XM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21177865", "url": "https://glygen.org/publication/PubMed/21177865" } ] }, { "title": "Phosphorylation of ULK1 (hATG1) by AMP-activated protein kinase connects energy sensing to mitophagy.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Egan DF, Shackelford DB, Mihaylova MM, Gelino S, Kohnz RA, Mair W, Vasquez DS, Joshi A, Gwinn DM, Taylor R, Asara JM, Fitzpatrick J, Dillin A, Viollet B, Kundu M, Hansen M, Shaw RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21205641", "url": "https://glygen.org/publication/PubMed/21205641" } ] }, { "title": "AMPK and mTOR regulate autophagy through direct phosphorylation of Ulk1.", "journal": "Nature cell biology", "date": "2011", "authors": "Kim J, Kundu M, Viollet B, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21258367", "url": "https://glygen.org/publication/PubMed/21258367" } ] }, { "title": "Evi1 represses PTEN expression and activates PI3K/AKT/mTOR via interactions with polycomb proteins.", "journal": "Blood", "date": "2011", "authors": "Yoshimi A, Goyama S, Watanabe-Okochi N, Yoshiki Y, Nannya Y, Nitta E, Arai S, Sato T, Shimabe M, Nakagawa M, Imai Y, Kitamura T, Kurokawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "21289308", "url": "https://glygen.org/publication/PubMed/21289308" } ] }, { "title": "Evidence for two CRIB domains in phospholipase D2 (PLD2) that the enzyme uses to specifically bind to the small GTPase Rac2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Peng HJ, Henkels KM, Mahankali M, Dinauer MC, Gomez-Cambronero J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "21378159", "url": "https://glygen.org/publication/PubMed/21378159" } ] }, { "title": "Nutrient starvation elicits an acute autophagic response mediated by Ulk1 dephosphorylation and its subsequent dissociation from AMPK.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Shang L, Chen S, Du F, Li S, Zhao L, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21383122", "url": "https://glygen.org/publication/PubMed/21383122" } ] }, { "title": "Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Jaiswal M, Gremer L, Dvorsky R, Haeusler LC, Cirstea IC, Uhlenbrock K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "21454492", "url": "https://glygen.org/publication/PubMed/21454492" } ] }, { "title": "The autophagy initiating kinase ULK1 is regulated via opposing phosphorylation by AMPK and mTOR.", "journal": "Autophagy", "date": "2011", "authors": "Egan D, Kim J, Shaw RJ, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21460621", "url": "https://glygen.org/publication/PubMed/21460621" } ] }, { "title": "The Rac1 exchange factor Dock5 is essential for bone resorption by osteoclasts.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2011", "authors": "Vives V, Laurin M, Cres G, Larrousse P, Morichaud Z, Noel D, Cote JF, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21542010", "url": "https://glygen.org/publication/PubMed/21542010" } ] }, { "title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Naji L, Pacholsky D, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21565175", "url": "https://glygen.org/publication/PubMed/21565175" } ] }, { "title": "Multiple factors confer specific Cdc42 and Rac protein activation by dedicator of cytokinesis (DOCK) nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kulkarni K, Yang J, Zhang Z, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21613211", "url": "https://glygen.org/publication/PubMed/21613211" } ] }, { "title": "Ephexin4 and EphA2 mediate resistance to anoikis through RhoG and phosphatidylinositol 3-kinase.", "journal": "Experimental cell research", "date": "2011", "authors": "Harada K, Hiramoto-Yamaki N, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "21621533", "url": "https://glygen.org/publication/PubMed/21621533" } ] }, { "title": "RasGRF suppresses Cdc42-mediated tumour cell movement, cytoskeletal dynamics and transformation.", "journal": "Nature cell biology", "date": "2011", "authors": "Calvo F, Sanz-Moreno V, Agudo-Ibanez L, Wallberg F, Sahai E, Marshall CJ, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "21685891", "url": "https://glygen.org/publication/PubMed/21685891" } ] }, { "title": "The IQGAP1 protein is a calmodulin-regulated barbed end capper of actin filaments: possible implications in its function in cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Pelikan-Conchaudron A, Le Clainche C, Didry D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21730051", "url": "https://glygen.org/publication/PubMed/21730051" } ] }, { "title": "Physical exercise regulates p53 activity targeting SCO2 and increases mitochondrial COX biogenesis in cardiac muscle with age.", "journal": "PloS one", "date": "2011", "authors": "Qi Z, He J, Su Y, He Q, Liu J, Yu L, Al-Attas O, Hussain T, Ding S, Ji L, Qian M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "21750704", "url": "https://glygen.org/publication/PubMed/21750704" } ] }, { "title": "The serine/threonine kinase ULK1 is a target of multiple phosphorylation events.", "journal": "The Biochemical journal", "date": "2011", "authors": "Bach M, Larance M, James DE, Ramm G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "21819378", "url": "https://glygen.org/publication/PubMed/21819378" } ] }, { "title": "ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Maeda M, Hasegawa H, Hyodo T, Ito S, Asano E, Yuang H, Funasaka K, Shimokata K, Hasegawa Y, Hamaguchi M, Senga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21865595", "url": "https://glygen.org/publication/PubMed/21865595" } ] }, { "title": "Biogenesis and assembly of eukaryotic cytochrome c oxidase catalytic core.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Soto IC, Fontanesi F, Liu J, Barrientos A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "21958598", "url": "https://glygen.org/publication/PubMed/21958598" } ] }, { "title": "Dysregulation of Rho GTPases in the alphaPix/Arhgef6 mouse model of X-linked intellectual disability is paralleled by impaired structural and synaptic plasticity and cognitive deficits.", "journal": "Human molecular genetics", "date": "2012", "authors": "Ramakers GJ, Wolfer D, Rosenberger G, Kuchenbecker K, Kreienkamp HJ, Prange-Kiel J, Rune G, Richter K, Langnaese K, Masneuf S, Bosl MR, Fischer KD, Krugers HJ, Lipp HP, van Galen E, Kutsche K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21989057", "url": "https://glygen.org/publication/PubMed/21989057" } ] }, { "title": "Detection of Rho GEF and GAP activity through a sensitive split luciferase assay system.", "journal": "The Biochemical journal", "date": "2012", "authors": "Anderson EL, Hamann MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22004470", "url": "https://glygen.org/publication/PubMed/22004470" } ] }, { "title": "mTORC1 senses lysosomal amino acids through an inside-out mechanism that requires the vacuolar H(+)-ATPase.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Zoncu R, Bar-Peled L, Efeyan A, Wang S, Sancak Y, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "22053050", "url": "https://glygen.org/publication/PubMed/22053050" } ] }, { "title": "ARHGAP25, a novel Rac GTPase-activating protein, regulates phagocytosis in human neutrophilic granulocytes.", "journal": "Blood", "date": "2012", "authors": "Csepanyi-Komi R, Sirokmany G, Geiszt M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22096251", "url": "https://glygen.org/publication/PubMed/22096251" } ] }, { "title": "Stem cell gene SALL4 suppresses transcription through recruitment of DNA methyltransferases.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Yang J, Corsello TR, Ma Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "22128185", "url": "https://glygen.org/publication/PubMed/22128185" } ] }, { "title": "The FAP motif within human ATG7, an autophagy-related E1-like enzyme, is essential for the E2-substrate reaction of LC3 lipidation.", "journal": "Autophagy", "date": "2012", "authors": "Tanida I, Yamasaki M, Komatsu M, Ueno T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "22170151", "url": "https://glygen.org/publication/PubMed/22170151" } ] }, { "title": "The GRAF family member oligophrenin1 is a RhoGAP with BAR domain and regulates Rho GTPases in platelets.", "journal": "Cardiovascular research", "date": "2012", "authors": "Elvers M, Beck S, Fotinos A, Ziegler M, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22298643", "url": "https://glygen.org/publication/PubMed/22298643" } ] }, { "title": "Sestrin2 modulates AMPK subunit expression and its response to ionizing radiation in breast cancer cells.", "journal": "PloS one", "date": "2012", "authors": "Sanli T, Linher-Melville K, Tsakiridis T, Singh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "22363791", "url": "https://glygen.org/publication/PubMed/22363791" } ] }, { "title": "RAC1 activation mediates Twist1-induced cancer cell migration.", "journal": "Nature cell biology", "date": "2012", "authors": "Yang WH, Lan HY, Huang CH, Tai SK, Tzeng CH, Kao SY, Wu KJ, Hung MC, Yang MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22407364", "url": "https://glygen.org/publication/PubMed/22407364" } ] }, { "title": "DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.", "journal": "Blood", "date": "2012", "authors": "Harada Y, Tanaka Y, Terasawa M, Pieczyk M, Habiro K, Katakai T, Hanawa-Suetsugu K, Kukimoto-Niino M, Nishizaki T, Shirouzu M, Duan X, Uruno T, Nishikimi A, Sanematsu F, Yokoyama S, Stein JV, Kinashi T, Fukui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "22461490", "url": "https://glygen.org/publication/PubMed/22461490" } ] }, { "title": "Dock7: a GEF for Rho-family GTPases and a novel myosin VI-binding partner in neuronal PC12 cells.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2012", "authors": "Majewski L, Sobczak M, Havrylov S, Jozwiak J, Redowicz MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22475431", "url": "https://glygen.org/publication/PubMed/22475431" } ] }, { "title": "Cdc42 and the guanine nucleotide exchange factors Ect2 and trio mediate Fn14-induced migration and invasion of glioblastoma cells.", "journal": "Molecular cancer research : MCR", "date": "2012", "authors": "Fortin SP, Ennis MJ, Schumacher CA, Zylstra-Diegel CR, Williams BO, Ross JT, Winkles JA, Loftus JC, Symons MH, Tran NL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "22571869", "url": "https://glygen.org/publication/PubMed/22571869" } ] }, { "title": "SH3BP4 is a negative regulator of amino acid-Rag GTPase-mTORC1 signaling.", "journal": "Molecular cell", "date": "2012", "authors": "Kim YM, Stone M, Hwang TH, Kim YG, Dunlevy JR, Griffin TJ, Kim DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "22575674", "url": "https://glygen.org/publication/PubMed/22575674" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "Structural insights into Atg10-mediated formation of the autophagy-essential Atg12-Atg5 conjugate.", "journal": "Structure (London, England : 1993)", "date": "2012", "authors": "Yamaguchi M, Noda NN, Yamamoto H, Shima T, Kumeta H, Kobashigawa Y, Akada R, Ohsumi Y, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "22682742", "url": "https://glygen.org/publication/PubMed/22682742" } ] }, { "title": "Dock3 regulates BDNF-TrkB signaling for neurite outgrowth by forming a ternary complex with Elmo and RhoG.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2012", "authors": "Namekata K, Watanabe H, Guo X, Kittaka D, Kawamura K, Kimura A, Harada C, Harada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22734669", "url": "https://glygen.org/publication/PubMed/22734669" } ] }, { "title": "NDUFA4 is a subunit of complex IV of the mammalian electron transport chain.", "journal": "Cell metabolism", "date": "2012", "authors": "Balsa E, Marco R, Perales-Clemente E, Szklarczyk R, Calvo E, Landazuri MO, Enriquez JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "22902835", "url": "https://glygen.org/publication/PubMed/22902835" } ] }, { "title": "Serine-71 phosphorylation of Rac1 modulates downstream signaling.", "journal": "PloS one", "date": "2012", "authors": "Schwarz J, Proff J, Havemeier A, Ladwein M, Rottner K, Barlag B, Pich A, Tatge H, Just I, Gerhard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22970203", "url": "https://glygen.org/publication/PubMed/22970203" } ] }, { "title": "RhoJ regulates melanoma chemoresistance by suppressing pathways that sense DNA damage.", "journal": "Cancer research", "date": "2012", "authors": "Ho H, Aruri J, Kapadia R, Mehr H, White MA, Ganesan AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "22971344", "url": "https://glygen.org/publication/PubMed/22971344" } ] }, { "title": "Ragulator is a GEF for the Rag GTPases that signal amino acid levels to mTORC1.", "journal": "Cell", "date": "2012", "authors": "Bar-Peled L, Schweitzer LD, Zoncu R, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "22980980", "url": "https://glygen.org/publication/PubMed/22980980" } ] }, { "title": "Arhgef15 promotes retinal angiogenesis by mediating VEGF-induced Cdc42 activation and potentiating RhoJ inactivation in endothelial cells.", "journal": "PloS one", "date": "2012", "authors": "Kusuhara S, Fukushima Y, Fukuhara S, Jakt LM, Okada M, Shimizu Y, Hata M, Nishida K, Negi A, Hirashima M, Mochizuki N, Nishikawa S, Uemura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "23029280", "url": "https://glygen.org/publication/PubMed/23029280" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "iPTMnet", "id": "Q6IAA8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "ARHGAP21 is a RhoGAP for RhoA and RhoC with a role in proliferation and migration of prostate adenocarcinoma cells.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Lazarini M, Traina F, Machado-Neto JA, Barcellos KS, Moreira YB, Brandao MM, Verjovski-Almeida S, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "23200924", "url": "https://glygen.org/publication/PubMed/23200924" } ] }, { "title": "The novel synaptogenic protein Farp1 links postsynaptic cytoskeletal dynamics and transsynaptic organization.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Cheadle L, Biederer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23209303", "url": "https://glygen.org/publication/PubMed/23209303" } ] }, { "title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Jaiswal M, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "23255595", "url": "https://glygen.org/publication/PubMed/23255595" } ] }, { "title": "Targeting transcription factor SALL4 in acute myeloid leukemia by interrupting its interaction with an epigenetic complex.", "journal": "Blood", "date": "2013", "authors": "Gao C, Dimitrov T, Yong KJ, Tatetsu H, Jeong HW, Luo HR, Bradner JE, Tenen DG, Chai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "23287862", "url": "https://glygen.org/publication/PubMed/23287862" } ] }, { "title": "Kalirin promotes neointimal hyperplasia by activating Rac in smooth muscle cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wu JH, Fanaroff AC, Sharma KC, Smith LS, Brian L, Eipper BA, Mains RE, Freedman NJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23288169", "url": "https://glygen.org/publication/PubMed/23288169" } ] }, { "title": "Reelin and the Cdc42/Rac1 guanine nucleotide exchange factor alphaPIX/Arhgef6 promote dendritic Golgi translocation in hippocampal neurons.", "journal": "The European journal of neuroscience", "date": "2013", "authors": "Meseke M, Rosenberger G, Forster E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "23406282", "url": "https://glygen.org/publication/PubMed/23406282" } ] }, { "title": "ARHGDIA: a novel gene implicated in nephrotic syndrome.", "journal": "Journal of medical genetics", "date": "2013", "authors": "Gupta IR, Baldwin C, Auguste D, Ha KC, El Andalousi J, Fahiminiya S, Bitzan M, Bernard C, Akbari MR, Narod SA, Rosenblatt DS, Majewski J, Takano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "23434736", "url": "https://glygen.org/publication/PubMed/23434736" } ] }, { "title": "Plekhg4 is a novel Dbl family guanine nucleotide exchange factor protein for rho family GTPases.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gupta M, Kamynina E, Morley S, Chung S, Muakkassa N, Wang H, Brathwaite S, Sharma G, Manor D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23572525", "url": "https://glygen.org/publication/PubMed/23572525" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "ULK1 induces autophagy by phosphorylating Beclin-1 and activating VPS34 lipid kinase.", "journal": "Nature cell biology", "date": "2013", "authors": "Russell RC, Tian Y, Yuan H, Park HW, Chang YY, Kim J, Kim H, Neufeld TP, Dillin A, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "23685627", "url": "https://glygen.org/publication/PubMed/23685627" } ] }, { "title": "ARF1 controls Rac1 signaling to regulate migration of MDA-MB-231 invasive breast cancer cells.", "journal": "Cellular signalling", "date": "2013", "authors": "Lewis-Saravalli S, Campbell S, Claing A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23707487", "url": "https://glygen.org/publication/PubMed/23707487" } ] }, { "title": "Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.", "journal": "Biochemistry", "date": "2013", "authors": "Zhou Y, Johnson JL, Cerione RA, Erickson JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23718289", "url": "https://glygen.org/publication/PubMed/23718289" } ] }, { "title": "A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.", "journal": "Science (New York, N.Y.)", "date": "2013", "authors": "Bar-Peled L, Chantranupong L, Cherniack AD, Chen WW, Ottina KA, Grabiner BC, Spear ED, Carter SL, Meyerson M, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "23723238", "url": "https://glygen.org/publication/PubMed/23723238" } ] }, { "title": "Autophagosome formation--the role of ULK1 and Beclin1-PI3KC3 complexes in setting the stage.", "journal": "Seminars in cancer biology", "date": "2013", "authors": "Wirth M, Joachim J, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "23727157", "url": "https://glygen.org/publication/PubMed/23727157" } ] }, { "title": "NDUFA4 mutations underlie dysfunction of a cytochrome c oxidase subunit linked to human neurological disease.", "journal": "Cell reports", "date": "2013", "authors": "Pitceathly RD, Rahman S, Wedatilake Y, Polke JM, Cirak S, Foley AR, Sailer A, Hurles ME, Stalker J, Hargreaves I, Woodward CE, Sweeney MG, Muntoni F, Houlden H, Taanman JW, Hanna MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "23746447", "url": "https://glygen.org/publication/PubMed/23746447" } ] }, { "title": "RNA-aptamers that modulate the RhoGEF activity of Tiam1.", "journal": "Bioorganic & medicinal chemistry", "date": "2013", "authors": "Niebel B, Wosnitza CI, Famulok M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "23757206", "url": "https://glygen.org/publication/PubMed/23757206" } ] }, { "title": "Diverse stresses dramatically alter genome-wide p53 binding and transactivation landscape in human cancer cells.", "journal": "Nucleic acids research", "date": "2013", "authors": "Menendez D, Nguyen TA, Freudenberg JM, Mathew VJ, Anderson CW, Jothi R, Resnick MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "23775793", "url": "https://glygen.org/publication/PubMed/23775793" } ] }, { "title": "The recruitment of p47(phox) and Rac2G12V at the phagosome is transient and phosphatidylserine dependent.", "journal": "Biology of the cell", "date": "2013", "authors": "Faure MC, Sulpice JC, Delattre M, Lavielle M, Prigent M, Cuif MH, Melchior C, Tschirhart E, Nusse O, Dupre-Crochet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "23870057", "url": "https://glygen.org/publication/PubMed/23870057" } ] }, { "title": "Temporal analysis of recruitment of mammalian ATG proteins to the autophagosome formation site.", "journal": "Autophagy", "date": "2013", "authors": "Koyama-Honda I, Itakura E, Fujiwara TK, Mizushima N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "23884233", "url": "https://glygen.org/publication/PubMed/23884233" } ] }, { "title": "RasGRF2 Rac-GEF activity couples NMDA receptor calcium flux to enhanced synaptic transmission.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Schwechter B, Rosenmund C, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23940355", "url": "https://glygen.org/publication/PubMed/23940355" } ] }, { "title": "Glucose-6-phosphate dehydrogenase: a biomarker and potential therapeutic target for cancer.", "journal": "Anti-cancer agents in medicinal chemistry", "date": "2014", "authors": "Zhang C, Zhang Z, Zhu Y, Qin S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "24066844", "url": "https://glygen.org/publication/PubMed/24066844" } ] }, { "title": "Recruitment of folliculin to lysosomes supports the amino acid-dependent activation of Rag GTPases.", "journal": "The Journal of cell biology", "date": "2013", "authors": "Petit CS, Roczniak-Ferguson A, Ferguson SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "24081491", "url": "https://glygen.org/publication/PubMed/24081491" } ] }, { "title": "The human minor histocompatibility antigen 1 is a RhoGAP.", "journal": "PloS one", "date": "2013", "authors": "de Kreuk BJ, Schaefer A, Anthony EC, Tol S, Fernandez-Borja M, Geerts D, Pool J, Hambach L, Goulmy E, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24086303", "url": "https://glygen.org/publication/PubMed/24086303" } ] }, { "title": "The folliculin tumor suppressor is a GAP for the RagC/D GTPases that signal amino acid levels to mTORC1.", "journal": "Molecular cell", "date": "2013", "authors": "Tsun ZY, Bar-Peled L, Chantranupong L, Zoncu R, Wang T, Kim C, Spooner E, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "24095279", "url": "https://glygen.org/publication/PubMed/24095279" } ] }, { "title": "The RhoGAP ARHGAP19 controls cytokinesis and chromosome segregation in T lymphocytes.", "journal": "Journal of cell science", "date": "2014", "authors": "David MD, Petit D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24259668", "url": "https://glygen.org/publication/PubMed/24259668" } ] }, { "title": "Collybistin activation by GTP-TC10 enhances postsynaptic gephyrin clustering and hippocampal GABAergic neurotransmission.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Mayer S, Kumar R, Jaiswal M, Soykan T, Ahmadian MR, Brose N, Betz H, Rhee JS, Papadopoulos T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "24297911", "url": "https://glygen.org/publication/PubMed/24297911" } ] }, { "title": "The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.", "journal": "Nature communications", "date": "2013", "authors": "Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24335996", "url": "https://glygen.org/publication/PubMed/24335996" } ] }, { "title": "Rho-GTPase-activating protein interacting with Cdc-42-interacting protein 4 homolog 2 (Rich2): a new Ras-related C3 botulinum toxin substrate 1 (Rac1) GTPase-activating protein that controls dendritic spine morphogenesis.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Raynaud F, Moutin E, Schmidt S, Dahl J, Bertaso F, Boeckers TM, Homburger V, Fagni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24352656", "url": "https://glygen.org/publication/PubMed/24352656" } ] }, { "title": "IQGAP1 is a key node within the small GTPase network.", "journal": "Small GTPases", "date": "2013", "authors": "Jacquemet G, Humphries MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "24355937", "url": "https://glygen.org/publication/PubMed/24355937" } ] }, { "title": "p53/TAp63 and AKT regulate mammalian target of rapamycin complex 1 (mTORC1) signaling through two independent parallel pathways in the presence of DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Cam M, Bid HK, Xiao L, Zambetti GP, Houghton PJ, Cam H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "24366874", "url": "https://glygen.org/publication/PubMed/24366874" } ] }, { "title": "TIGAR, TIGAR, burning bright.", "journal": "Cancer & metabolism", "date": "2014", "authors": "Lee P, Vousden KH, Cheung EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "24383451", "url": "https://glygen.org/publication/PubMed/24383451" } ] }, { "title": "Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Kast DJ, Yang C, Disanza A, Boczkowska M, Madasu Y, Scita G, Svitkina T, Dominguez R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "24584464", "url": "https://glygen.org/publication/PubMed/24584464" } ] }, { "title": "The phosphatidylserine receptor TIM4 utilizes integrins as coreceptors to effect phagocytosis.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Flannagan RS, Canton J, Furuya W, Glogauer M, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "24623723", "url": "https://glygen.org/publication/PubMed/24623723" } ] }, { "title": "P-Rex1 directly activates RhoG to regulate GPCR-driven Rac signalling and actin polarity in neutrophils.", "journal": "Journal of cell science", "date": "2014", "authors": "Damoulakis G, Gambardella L, Rossman KL, Lawson CD, Anderson KE, Fukui Y, Welch HC, Der CJ, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "24659802", "url": "https://glygen.org/publication/PubMed/24659802" } ] }, { "title": "The tumor suppressor PTEN interacts with p53 in hereditary cancer (Review).", "journal": "International journal of oncology", "date": "2014", "authors": "Nakanishi A, Kitagishi Y, Ogura Y, Matsuda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "24718924", "url": "https://glygen.org/publication/PubMed/24718924" } ] }, { "title": "Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.", "journal": "Nature cell biology", "date": "2014", "authors": "Nath S, Dancourt J, Shteyn V, Puente G, Fong WM, Nag S, Bewersdorf J, Yamamoto A, Antonny B, Melia TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "24747438", "url": "https://glygen.org/publication/PubMed/24747438" } ] }, { "title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.", "journal": "Nature cell biology", "date": "2014", "authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24859002", "url": "https://glygen.org/publication/PubMed/24859002" } ] }, { "title": "ARHGAP22 localizes at endosomes and regulates actin cytoskeleton.", "journal": "PloS one", "date": "2014", "authors": "Mori M, Saito K, Ohta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24933155", "url": "https://glygen.org/publication/PubMed/24933155" } ] }, { "title": "WIPI2 links LC3 conjugation with PI3P, autophagosome formation, and pathogen clearance by recruiting Atg12-5-16L1.", "journal": "Molecular cell", "date": "2014", "authors": "Dooley HC, Razi M, Polson HE, Girardin SE, Wilson MI, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "24954904", "url": "https://glygen.org/publication/PubMed/24954904" } ] }, { "title": "Dynamic control of excitatory synapse development by a Rac1 GEF/GAP regulatory complex.", "journal": "Developmental cell", "date": "2014", "authors": "Um K, Niu S, Duman JG, Cheng JX, Tu YK, Schwechter B, Liu F, Hiles L, Narayanan AS, Ash RT, Mulherkar S, Alpadi K, Smirnakis SM, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24960694", "url": "https://glygen.org/publication/PubMed/24960694" } ] }, { "title": "Activation of Cdc42 is necessary for sustained oscillations of Ca2+ and PIP2 stimulated by antigen in RBL mast cells.", "journal": "Biology open", "date": "2014", "authors": "Wilkes MM, Wilson JD, Baird B, Holowka D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "24996924", "url": "https://glygen.org/publication/PubMed/24996924" } ] }, { "title": "Arhgap36-dependent activation of Gli transcription factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Rack PG, Ni J, Payumo AY, Nguyen V, Crapster JA, Hovestadt V, Kool M, Jones DT, Mich JK, Firestone AJ, Pfister SM, Cho YJ, Chen JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25024229", "url": "https://glygen.org/publication/PubMed/25024229" } ] }, { "title": "Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.", "journal": "PloS one", "date": "2014", "authors": "Yeung CY, Taylor SH, Garva R, Holmes DF, Zeef LA, Soininen R, Boot-Handford RP, Kadler KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25211221", "url": "https://glygen.org/publication/PubMed/25211221" } ] }, { "title": "Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.", "journal": "Nat. Commun.", "date": "2014", "authors": "Thinon E, Serwa RA, Broncel M, Brannigan JA, Brassat U, Wright MH, Heal WP, Wilkinson AJ, Mann DJ, Tate EW", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "25255805", "url": "https://glygen.org/publication/PubMed/25255805" } ] }, { "title": "Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.", "journal": "Cell", "date": "2014", "authors": "Peng M, Yin N, Li MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "25259925", "url": "https://glygen.org/publication/PubMed/25259925" } ] }, { "title": "The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.", "journal": "Cell reports", "date": "2014", "authors": "Chantranupong L, Wolfson RL, Orozco JM, Saxton RA, Scaria SM, Bar-Peled L, Spooner E, Isasa M, Gygi SP, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "25263562", "url": "https://glygen.org/publication/PubMed/25263562" } ] }, { "title": "CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.", "journal": "Oncotarget", "date": "2015", "authors": "Wang SJ, Cui HY, Liu YM, Zhao P, Zhang Y, Fu ZG, Chen ZN, Jiang JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25428919", "url": "https://glygen.org/publication/PubMed/25428919" } ] }, { "title": "Sestrins inhibit mTORC1 kinase activation through the GATOR complex.", "journal": "Cell reports", "date": "2014", "authors": "Parmigiani A, Nourbakhsh A, Ding B, Wang W, Kim YC, Akopiants K, Guan KL, Karin M, Budanov AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "25457612", "url": "https://glygen.org/publication/PubMed/25457612" } ] }, { "title": "SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.", "journal": "Nature", "date": "2015", "authors": "Rebsamen M, Pochini L, Stasyk T, de Araujo ME, Galluccio M, Kandasamy RK, Snijder B, Fauster A, Rudashevskaya EL, Bruckner M, Scorzoni S, Filipek PA, Huber KV, Bigenzahn JW, Heinz LX, Kraft C, Bennett KL, Indiveri C, Huber LA, Superti-Furga G", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "25561175", "url": "https://glygen.org/publication/PubMed/25561175" } ] }, { "title": "Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.", "journal": "Science", "date": "2015", "authors": "Wang S, Tsun ZY, Wolfson RL, Shen K, Wyant GA, Plovanich ME, Yuan ED, Jones TD, Chantranupong L, Comb W, Wang T, Bar-Peled L, Zoncu R, Straub C, Kim C, Park J, Sabatini BL, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "25567906", "url": "https://glygen.org/publication/PubMed/25567906" } ] }, { "title": "Membrane dynamics in autophagosome biogenesis.", "journal": "Journal of cell science", "date": "2015", "authors": "Carlsson SR, Simonsen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "25568151", "url": "https://glygen.org/publication/PubMed/25568151" } ] }, { "title": "Peroxiredoxin 1 promotes tumorigenesis through regulating the activity of mTOR/p70S6K pathway in esophageal squamous cell carcinoma.", "journal": "Medical oncology (Northwood, London, England)", "date": "2015", "authors": "Gong F, Hou G, Liu H, Zhang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "25579166", "url": "https://glygen.org/publication/PubMed/25579166" } ] }, { "title": "Lipid binding defects and perturbed synaptogenic activity of a Collybistin R290H mutant that causes epilepsy and intellectual disability.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Papadopoulos T, Schemm R, Grubmuller H, Brose N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "25678704", "url": "https://glygen.org/publication/PubMed/25678704" } ] }, { "title": "Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.", "journal": "Experimental cell research", "date": "2015", "authors": "Wu D, Zhu X, Jimenez-Cowell K, Mold AJ, Sollecito CC, Lombana N, Jiao M, Wei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25704760", "url": "https://glygen.org/publication/PubMed/25704760" } ] }, { "title": "Human-specific gene ARHGAP11B promotes basal progenitor amplification and neocortex expansion.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Florio M, Albert M, Taverna E, Namba T, Brandl H, Lewitus E, Haffner C, Sykes A, Wong FK, Peters J, Guhr E, Klemroth S, Prufer K, Kelso J, Naumann R, Nusslein I, Dahl A, Lachmann R, Paabo S, Huttner WB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25721503", "url": "https://glygen.org/publication/PubMed/25721503" } ] }, { "title": "SLUG is a direct transcriptional repressor of PTEN tumor suppressor.", "journal": "The Prostate", "date": "2015", "authors": "Uygur B, Abramo K, Leikina E, Vary C, Liaw L, Wu WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "25728608", "url": "https://glygen.org/publication/PubMed/25728608" } ] }, { "title": "Rho guanine nucleotide exchange factors involved in cyclic-stretch-induced reorientation of vascular endothelial cells.", "journal": "Journal of cell science", "date": "2015", "authors": "Abiko H, Fujiwara S, Ohashi K, Hiatari R, Mashiko T, Sakamoto N, Sato M, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25795300", "url": "https://glygen.org/publication/PubMed/25795300" } ] }, { "title": "Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.", "journal": "Angew. Chem. Int. Ed.", "date": "2015", "authors": "Krause E., Broncel M., Serwa R.A., Tate E.W., Ciepla P., Dallman M.J., Magee A.I.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "25807930", "url": "https://glygen.org/publication/PubMed/25807930" } ] }, { "title": "Sestrin2 inhibits mTORC1 through modulation of GATOR complexes.", "journal": "Scientific reports", "date": "2015", "authors": "Kim JS, Ro SH, Kim M, Park HW, Semple IA, Park H, Cho US, Wang W, Guan KL, Karin M, Lee JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "25819761", "url": "https://glygen.org/publication/PubMed/25819761" } ] }, { "title": "Dock10, a Cdc42 and Rac1 GEF, induces loss of elongation, filopodia, and ruffles in cervical cancer epithelial HeLa cells.", "journal": "Biology open", "date": "2015", "authors": "Ruiz-Lafuente N, Alcaraz-Garcia MJ, Garcia-Serna AM, Sebastian-Ruiz S, Moya-Quiles MR, Garcia-Alonso AM, Parrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25862245", "url": "https://glygen.org/publication/PubMed/25862245" } ] }, { "title": "Amino Acid-Dependent mTORC1 Regulation by the Lysosomal Membrane Protein SLC38A9.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Jung J, Genau HM, Behrends C", "evidence": [ { "database": "Reactome", "id": "R-HSA-165159", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159" } ], "reference": [ { "type": "PubMed", "id": "25963655", "url": "https://glygen.org/publication/PubMed/25963655" } ] }, { "title": "The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.", "journal": "Nature communications", "date": "2015", "authors": "Kuhn S, Erdmann C, Kage F, Block J, Schwenkmezger L, Steffen A, Rottner K, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "25963737", "url": "https://glygen.org/publication/PubMed/25963737" } ] }, { "title": "Mitochondrial Dysfunction in Human Leukemic Stem/Progenitor Cells upon Loss of RAC2.", "journal": "PloS one", "date": "2015", "authors": "Capala ME, Maat H, Bonardi F, van den Boom V, Kuipers J, Vellenga E, Giepmans BN, Schuringa JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "26016997", "url": "https://glygen.org/publication/PubMed/26016997" } ] }, { "title": "A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis.", "journal": "Nature communications", "date": "2015", "authors": "Abraham S, Scarcia M, Bagshaw RD, McMahon K, Grant G, Harvey T, Yeo M, Esteves FOG, Thygesen HH, Jones PF, Speirs V, Hanby AM, Selby PJ, Lorger M, Dear TN, Pawson T, Marshall CJ, Mavria G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26129894", "url": "https://glygen.org/publication/PubMed/26129894" } ] }, { "title": "The Formin FMNL3 Controls Early Apical Specification in Endothelial Cells by Regulating the Polarized Trafficking of Podocalyxin.", "journal": "Current biology : CB", "date": "2015", "authors": "Richards M, Hetheridge C, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "26299518", "url": "https://glygen.org/publication/PubMed/26299518" } ] }, { "title": "Sestrin2 is a leucine sensor for the mTORC1 pathway.", "journal": "Science (New York, N.Y.)", "date": "2016", "authors": "Wolfson RL, Chantranupong L, Saxton RA, Shen K, Scaria SM, Cantor JR, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "26449471", "url": "https://glygen.org/publication/PubMed/26449471" } ] }, { "title": "Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.", "journal": "The Journal of clinical investigation", "date": "2015", "authors": "Kong R, Yi F, Wen P, Liu J, Chen X, Ren J, Li X, Shang Y, Nie Y, Wu K, Fan D, Zhu L, Feng W, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26529257", "url": "https://glygen.org/publication/PubMed/26529257" } ] }, { "title": "Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.", "journal": "Science (New York, N.Y.)", "date": "2016", "authors": "Saxton RA, Knockenhauer KE, Wolfson RL, Chantranupong L, Pacold ME, Wang T, Schwartz TU, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "26586190", "url": "https://glygen.org/publication/PubMed/26586190" } ] }, { "title": "PAK6 targets to cell-cell adhesions through its N-terminus in a Cdc42-dependent manner to drive epithelial colony escape.", "journal": "Journal of cell science", "date": "2016", "authors": "Morse EM, Sun X, Olberding JR, Ha BH, Boggon TJ, Calderwood DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "26598554", "url": "https://glygen.org/publication/PubMed/26598554" } ] }, { "title": "Inhibitory effects of Arhgap6 on cervical carcinoma cells.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2016", "authors": "Li J, Liu Y, Yin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "26628301", "url": "https://glygen.org/publication/PubMed/26628301" } ] }, { "title": "Novel therapeutic interventions for p53-altered tumors through manipulation of its family members, p63 and p73.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2016", "authors": "Venkatanarayan A, Raulji P, Norton W, Flores ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "26652033", "url": "https://glygen.org/publication/PubMed/26652033" } ] }, { "title": "Differential Rac1 signalling by guanine nucleotide exchange factors implicates FLII in regulating Rac1-driven cell migration.", "journal": "Nature communications", "date": "2016", "authors": "Marei H, Carpy A, Woroniuk A, Vennin C, White G, Timpson P, Macek B, Malliri A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26887924", "url": "https://glygen.org/publication/PubMed/26887924" } ] }, { "title": "MAF1 suppresses AKT-mTOR signaling and liver cancer through activation of PTEN transcription.", "journal": "Hepatology (Baltimore, Md.)", "date": "2016", "authors": "Li Y, Tsang CK, Wang S, Li XX, Yang Y, Fu L, Huang W, Li M, Wang HY, Zheng XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8943724", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724" } ], "reference": [ { "type": "PubMed", "id": "26910647", "url": "https://glygen.org/publication/PubMed/26910647" } ] }, { "title": "The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.", "journal": "Cell", "date": "2016", "authors": "Chantranupong L, Scaria SM, Saxton RA, Gygi MP, Shen K, Wyant GA, Wang T, Harper JW, Gygi SP, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "26972053", "url": "https://glygen.org/publication/PubMed/26972053" } ] }, { "title": "Galpha13 Stimulates the Tyrosine Phosphorylation of Ric-8A.", "journal": "Journal of molecular signaling", "date": "2015", "authors": "Yan M, Ha JH, Dhanasekaran DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "27096001", "url": "https://glygen.org/publication/PubMed/27096001" } ] }, { "title": "Oligophrenin1 protects mice against myocardial ischemia and reperfusion injury by modulating inflammation and myocardial apoptosis.", "journal": "Cellular signalling", "date": "2016", "authors": "Niermann C, Gorressen S, Klier M, Gowert NS, Billuart P, Kelm M, Merx MW, Elvers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27117132", "url": "https://glygen.org/publication/PubMed/27117132" } ] }, { "title": "ARHGEF15 overexpression worsens the prognosis in patients with pancreatic ductal adenocarcinoma through enhancing the motility and proliferative activity of the cancer cells.", "journal": "Molecular cancer", "date": "2016", "authors": "Fukushima H, Yasumoto M, Ogasawara S, Akiba J, Kitasato Y, Nakayama M, Naito Y, Ishida Y, Okabe Y, Yasunaga M, Horiuchi H, Sakamoto E, Itadani H, Mizuarai S, Oie S, Yano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27145964", "url": "https://glygen.org/publication/PubMed/27145964" } ] }, { "title": "Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers.", "journal": "Cancer research", "date": "2016", "authors": "Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27216196", "url": "https://glygen.org/publication/PubMed/27216196" } ] }, { "title": "SESTRINs regulate mTORC1 via RRAGs: The riddle of GATOR.", "journal": "Molecular & cellular oncology", "date": "2015", "authors": "Budanov AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "27308486", "url": "https://glygen.org/publication/PubMed/27308486" } ] }, { "title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "27481945", "url": "https://glygen.org/publication/PubMed/27481945" } ] }, { "title": "Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.", "journal": "Nature", "date": "2016", "authors": "Saxton RA, Chantranupong L, Knockenhauer KE, Schwartz TU, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "27487210", "url": "https://glygen.org/publication/PubMed/27487210" } ] }, { "title": "PLEKHG3 enhances polarized cell migration by activating actin filaments at the cell front.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Nguyen TT, Park WS, Park BO, Kim CY, Oh Y, Kim JM, Choi H, Kyung T, Kim CH, Lee G, Hahn KM, Meyer T, Heo WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27555588", "url": "https://glygen.org/publication/PubMed/27555588" } ] }, { "title": "Rac GTPase Activating Protein ARHGAP25 Regulates Leukocyte Transendothelial Migration in Mice.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Csepanyi-Komi R, Wisniewski E, Bartos B, Levai P, Nemeth T, Balazs B, Kurz AR, Bierschenk S, Sperandio M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27566826", "url": "https://glygen.org/publication/PubMed/27566826" } ] }, { "title": "Structural insight into the arginine-binding specificity of CASTOR1 in amino acid-dependent mTORC1 signaling.", "journal": "Cell discovery", "date": "2016", "authors": "Xia J, Wang R, Zhang T, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "27648300", "url": "https://glygen.org/publication/PubMed/27648300" } ] }, { "title": "Disruption of ArhGAP15 results in hyperactive Rac1, affects the architecture and function of hippocampal inhibitory neurons and causes cognitive deficits.", "journal": "Scientific reports", "date": "2016", "authors": "Zamboni V, Armentano M, Saro G, Ciraolo E, Ghigo A, Germena G, Umbach A, Valnegri P, Passafaro M, Carabelli V, Gavello D, Bianchi V, D'Adamo P, de Curtis I, El-Assawi N, Mauro A, Priano L, Ferri N, Hirsch E, Merlo GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27713499", "url": "https://glygen.org/publication/PubMed/27713499" } ] }, { "title": "Heme drives hemolysis-induced susceptibility to infection via disruption of phagocyte functions.", "journal": "Nature immunology", "date": "2016", "authors": "Martins R, Maier J, Gorki AD, Huber KV, Sharif O, Starkl P, Saluzzo S, Quattrone F, Gawish R, Lakovits K, Aichinger MC, Radic-Sarikas B, Lardeau CH, Hladik A, Korosec A, Brown M, Vaahtomeri K, Duggan M, Kerjaschki D, Esterbauer H, Colinge J, Eisenbarth SC, Decker T, Bennett KL, Kubicek S, Sixt M, Superti-Furga G, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "27798618", "url": "https://glygen.org/publication/PubMed/27798618" } ] }, { "title": "SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis.", "journal": "Cell reports", "date": "2016", "authors": "Baranov MV, Revelo NH, Dingjan I, Maraspini R, Ter Beest M, Honigmann A, van den Bogaart G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27806292", "url": "https://glygen.org/publication/PubMed/27806292" } ] }, { "title": "LRCH1 interferes with DOCK8-Cdc42-induced T cell migration and ameliorates experimental autoimmune encephalomyelitis.", "journal": "The Journal of experimental medicine", "date": "2017", "authors": "Xu X, Han L, Zhao G, Xue S, Gao Y, Xiao J, Zhang S, Chen P, Wu ZY, Ding J, Hu R, Wei B, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28028151", "url": "https://glygen.org/publication/PubMed/28028151" } ] }, { "title": "Structural mechanism for the arginine sensing and regulation of CASTOR1 in the mTORC1 signaling pathway.", "journal": "Cell discovery", "date": "2016", "authors": "Gai Z, Wang Q, Yang C, Wang L, Deng W, Wu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "28066558", "url": "https://glygen.org/publication/PubMed/28066558" } ] }, { "title": "RhoGTPase Regulators Orchestrate Distinct Stages of Synaptic Development.", "journal": "PloS one", "date": "2017", "authors": "Martin-Vilchez S, Whitmore L, Asmussen H, Zareno J, Horwitz R, Newell-Litwa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "28114311", "url": "https://glygen.org/publication/PubMed/28114311" } ] }, { "title": "Characterization of the activation of small GTPases by their GEFs on membranes using artificial membrane tethering.", "journal": "The Biochemical journal", "date": "2017", "authors": "Peurois F, Veyron S, Ferrandez Y, Ladid I, Benabdi S, Zeghouf M, Peyroche G, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "28196833", "url": "https://glygen.org/publication/PubMed/28196833" } ] }, { "title": "KICSTOR recruits GATOR1 to the lysosome and is necessary for nutrients to regulate mTORC1.", "journal": "Nature", "date": "2017", "authors": "Wolfson RL, Chantranupong L, Wyant GA, Gu X, Orozco JM, Shen K, Condon KJ, Petri S, Kedir J, Scaria SM, Abu-Remaileh M, Frankel WN, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "28199306", "url": "https://glygen.org/publication/PubMed/28199306" } ] }, { "title": "SZT2 dictates GATOR control of mTORC1 signalling.", "journal": "Nature", "date": "2017", "authors": "Peng M, Yin N, Li MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "28199315", "url": "https://glygen.org/publication/PubMed/28199315" } ] }, { "title": "Phosphorylated cortactin recruits Vav2 guanine nucleotide exchange factor to activate Rac3 and promote invadopodial function in invasive breast cancer cells.", "journal": "Molecular biology of the cell", "date": "2017", "authors": "Rosenberg BJ, Gil-Henn H, Mader CC, Halo T, Yin T, Condeelis J, Machida K, Wu YI, Koleske AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "28356423", "url": "https://glygen.org/publication/PubMed/28356423" } ] }, { "title": "An apical MRCK-driven morphogenetic pathway controls epithelial polarity.", "journal": "Nature cell biology", "date": "2017", "authors": "Zihni C, Vlassaks E, Terry S, Carlton J, Leung TKC, Olson M, Pichaud F, Balda MS, Matter K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28825699", "url": "https://glygen.org/publication/PubMed/28825699" } ] }, { "title": "A CDC42-centered signaling unit is a dominant positive regulator of endothelial integrity.", "journal": "Scientific reports", "date": "2017", "authors": "Amado-Azevedo J, Reinhard NR, van Bezu J, de Menezes RX, van Beusechem VW, van Nieuw Amerongen GP, van Hinsbergh VWM, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28860633", "url": "https://glygen.org/publication/PubMed/28860633" } ] }, { "title": "Crystal structure of the human lysosomal mTORC1 scaffold complex and its impact on signaling.", "journal": "Science", "date": "2017", "authors": "de Araujo MEG, Naschberger A, Furnrohr BG, Stasyk T, Dunzendorfer-Matt T, Lechner S, Welti S, Kremser L, Shivalingaiah G, Offterdinger M, Lindner HH, Huber LA, Scheffzek K", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "28935770", "url": "https://glygen.org/publication/PubMed/28935770" } ] }, { "title": "mTORC1 Activator SLC38A9 Is Required to Efflux Essential Amino Acids from Lysosomes and Use Protein as a Nutrient.", "journal": "Cell", "date": "2017", "authors": "Wyant GA, Abu-Remaileh M, Wolfson RL, Chen WW, Freinkman E, Danai LV, Vander Heiden MG, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "29053970", "url": "https://glygen.org/publication/PubMed/29053970" } ] }, { "title": "Intersubunit Crosstalk in the Rag GTPase Heterodimer Enables mTORC1 to Respond Rapidly to Amino Acid Availability.", "journal": "Molecular cell", "date": "2017", "authors": "Shen K, Choe A, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "29056322", "url": "https://glygen.org/publication/PubMed/29056322" } ] }, { "title": "Allosteric inhibition of the guanine nucleotide exchange factor DOCK5 by a small molecule.", "journal": "Scientific reports", "date": "2017", "authors": "Ferrandez Y, Zhang W, Peurois F, Akendengue L, Blangy A, Zeghouf M, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29089502", "url": "https://glygen.org/publication/PubMed/29089502" } ] }, { "title": "Hybrid Structure of the RagA/C-Ragulator mTORC1 Activation Complex.", "journal": "Mol. Cell", "date": "2017", "authors": "Su MY, Morris KL, Kim DJ, Fu Y, Lawrence R, Stjepanovic G, Zoncu R, Hurley JH", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "29107538", "url": "https://glygen.org/publication/PubMed/29107538" } ] }, { "title": "SAMTOR is an S-adenosylmethionine sensor for the mTORC1 pathway.", "journal": "Science (New York, N.Y.)", "date": "2017", "authors": "Gu X, Orozco JM, Saxton RA, Condon KJ, Liu GY, Krawczyk PA, Scaria SM, Harper JW, Gygi SP, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "29123071", "url": "https://glygen.org/publication/PubMed/29123071" } ] }, { "title": "Structural basis for Ragulator functioning as a scaffold in membrane-anchoring of Rag GTPases and mTORC1.", "journal": "Nat. Commun.", "date": "2017", "authors": "Zhang Tianlong, Wang Rong, Wang Zhijing, Wang Xiangxiang, Wang Fang, Ding Jianping", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "29123114", "url": "https://glygen.org/publication/PubMed/29123114" } ] }, { "title": "Structural basis for the assembly of the Ragulator-Rag GTPase complex.", "journal": "Nat. Commun.", "date": "2017", "authors": "Li S., Ogawa A., Okada M., Yamashita E., Nakagawa A., Nakayama K.I., Kitamura A., Nada S., Nakai M., Nakai T., Standley D.M., Nakatsumi H., Yonehara R.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "29158492", "url": "https://glygen.org/publication/PubMed/29158492" } ] }, { "title": "Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.", "journal": "Nature", "date": "2017", "authors": "Yang H, Jiang X, Li B, Yang HJ, Miller M, Yang A, Dhar A, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "29236692", "url": "https://glygen.org/publication/PubMed/29236692" } ] }, { "title": "Structural insight into the Ragulator complex which anchors mTORC1 to the lysosomal membrane.", "journal": "Cell Discov.", "date": "2017", "authors": "Mu Zongkai, Wang Lei, Deng Wei, Wang Jiawei, Wu Geng", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "29285400", "url": "https://glygen.org/publication/PubMed/29285400" } ] }, { "title": "Unraveling the molecular mechanism of interactions of the Rho GTPases Cdc42 and Rac1 with the scaffolding protein IQGAP2.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Ozdemir ES, Jang H, Gursoy A, Keskin O, Li Z, Sacks DB, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29358323", "url": "https://glygen.org/publication/PubMed/29358323" } ] }, { "title": "ARHGEF39 promotes tumor progression via activation of Rac1/P38 MAPK/ATF2 signaling and predicts poor prognosis in non-small cell lung cancer patients.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2018", "authors": "Zhou H, Cai L, Zhang X, Li A, Miao Y, Li Q, Qiu X, Wang E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29382922", "url": "https://glygen.org/publication/PubMed/29382922" } ] }, { "title": "An RNAi screen of Rho signalling networks identifies RhoH as a regulator of Rac1 in prostate cancer cell migration.", "journal": "BMC biology", "date": "2018", "authors": "Tajadura-Ortega V, Garg R, Allen R, Owczarek C, Bright MD, Kean S, Mohd-Noor A, Grigoriadis A, Elston TC, Hahn KM, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407" } ], "reference": [ { "type": "PubMed", "id": "29510700", "url": "https://glygen.org/publication/PubMed/29510700" } ] }, { "title": "TMEM55B contributes to lysosomal homeostasis and amino acid-induced mTORC1 activation.", "journal": "Genes Cells", "date": "2018", "authors": "Hashimoto Y, Shirane M, Nakayama KI", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "29644770", "url": "https://glygen.org/publication/PubMed/29644770" } ] }, { "title": "A nutrient-induced affinity switch controls mTORC1 activation by its Rag GTPase-Ragulator lysosomal scaffold.", "journal": "Nature cell biology", "date": "2018", "authors": "Lawrence RE, Cho KF, Rappold R, Thrun A, Tofaute M, Kim DJ, Moldavski O, Hurley JH, Zoncu R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "30061680", "url": "https://glygen.org/publication/PubMed/30061680" } ] }, { "title": "FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2018", "authors": "Chan Wah Hak L, Khan S, Di Meglio I, Law AL, Lucken-Ardjomande Hasler S, Quintaneiro LM, Ferreira APA, Krause M, McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "30061681", "url": "https://glygen.org/publication/PubMed/30061681" } ] }, { "title": "Ragulator and SLC38A9 activate the Rag GTPases through noncanonical GEF mechanisms.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2018", "authors": "Shen K, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "30181260", "url": "https://glygen.org/publication/PubMed/30181260" } ] }, { "title": "Arg-78 of Nprl2 catalyzes GATOR1-stimulated GTP hydrolysis by the Rag GTPases.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Shen K, Valenstein ML, Gu X, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "30651352", "url": "https://glygen.org/publication/PubMed/30651352" } ] }, { "title": "Structural Basis for the Dual Substrate Specificity of DOCK7 Guanine Nucleotide Exchange Factor.", "journal": "Structure (London, England : 1993)", "date": "2019", "authors": "Kukimoto-Niino M, Tsuda K, Ihara K, Mishima-Tsumagari C, Honda K, Ohsawa N, Shirouzu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "30853411", "url": "https://glygen.org/publication/PubMed/30853411" } ] }, { "title": "mTORC1 signaling is palmitoylation-dependent in hippocampal neurons and non-neuronal cells and involves dynamic palmitoylation of LAMTOR1 and mTOR.", "journal": "Front. Cell. Neurosci.", "date": "2019", "authors": "Sanders Shaun S, De Simone Francesca I, Thomas Gareth M", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "31001086", "url": "https://glygen.org/publication/PubMed/31001086" } ] }, { "title": "Nonconserved miR-608 suppresses prostate cancer progression through RAC2/PAK4/LIMK1 and BCL2L1/caspase-3 pathways by targeting the 3'-UTRs of RAC2/BCL2L1 and the coding region of PAK4.", "journal": "Cancer medicine", "date": "2019", "authors": "Zhang X, Fang J, Chen S, Wang W, Meng S, Liu B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "31389670", "url": "https://glygen.org/publication/PubMed/31389670" } ] }, { "title": "Structural basis for the docking of mTORC1 on the lysosomal surface.", "journal": "Science", "date": "2019", "authors": "Rogala KB, Gu X, Kedir JF, Abu-Remaileh M, Bianchi LF, Bottino AMS, Dueholm R, Niehaus A, Overwijn D, Fils AP, Zhou SX, Leary D, Laqtom NN, Brignole EJ, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "31601708", "url": "https://glygen.org/publication/PubMed/31601708" } ] }, { "title": "Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.", "journal": "Science", "date": "2019", "authors": "Lawrence RE, Fromm SA, Fu Y, Yokom AL, Kim DJ, Thelen AM, Young LN, Lim CY, Samelson AJ, Hurley JH, Zoncu R", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "31672913", "url": "https://glygen.org/publication/PubMed/31672913" } ] }, { "title": "Cryo-EM structure of the human FLCN-FNIP2-Rag-Ragulator complex.", "journal": "Cell", "date": "2019", "authors": "Shen K, Rogala KB, Chou HT, Huang RK, Yu Z, Sabatini DM", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "31704029", "url": "https://glygen.org/publication/PubMed/31704029" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Systems analysis of RhoGEF and RhoGAP regulatory proteins reveals spatially organized RAC1 signalling from integrin adhesions.", "journal": "Nature cell biology", "date": "2020", "authors": "Muller PM, Rademacher J, Bagshaw RD, Wortmann C, Barth C, van Unen J, Alp KM, Giudice G, Eccles RL, Heinrich LE, Pascual-Vargas P, Sanchez-Castro M, Brandenburg L, Mbamalu G, Tucholska M, Spatt L, Czajkowski MT, Welke RW, Zhang S, Nguyen V, Rrustemi T, Trnka P, Freitag K, Larsen B, Popp O, Mertins P, Gingras AC, Roth FP, Colwill K, Bakal C, Pertz O, Pawson T, Petsalaki E, Rocks O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "32203420", "url": "https://glygen.org/publication/PubMed/32203420" } ] }, { "title": "RhoJ Regulates alpha5beta1 Integrin Trafficking to Control Fibronectin Remodeling during Angiogenesis.", "journal": "Current biology : CB", "date": "2020", "authors": "Sundararaman A, Fukushima Y, Norman JC, Uemura A, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409" } ], "reference": [ { "type": "PubMed", "id": "32302585", "url": "https://glygen.org/publication/PubMed/32302585" } ] }, { "title": "N-myristoyltransferase-1 is necessary for lysosomal degradation and mTORC1 activation in cancer cells.", "journal": "Sci. Rep.", "date": "2020", "authors": "Wang F., Wang Y., Lee D.J., Chen Y.C., Chou T.F., Diaz B., Chen K.T., McClintock N.C., Navarrete M.S., Rehan V.K., Sakurai R.", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "32686708", "url": "https://glygen.org/publication/PubMed/32686708" } ] }, { "title": "Structural mechanism for amino acid-dependent Rag GTPase nucleotide state switching by SLC38A9.", "journal": "Nat. Struct. Mol. Biol.", "date": "2020", "authors": "Fromm SA, Lawrence RE, Hurley JH", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "32868926", "url": "https://glygen.org/publication/PubMed/32868926" } ] }, { "title": "N-myristoyltransferase-1 deficiency blocks myristoylation of LAMTOR1 and inhibits bladder cancer progression.", "journal": "Cancer Lett.", "date": "2022", "authors": "Sun Y, Guan Z, Sheng Q, Duan W, Zhao H, Zhou J, Deng Q, Pei X", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" } ], "reference": [ { "type": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" } ] }, { "title": "Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.", "journal": "Mol. Cell", "date": "2022", "authors": "Egri Shawn B, Ouch Christna, Chou Hui-Ting, Yu Zhiheng, Song Kangkang, Xu Chen, Shen Kuang", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "35338845", "url": "https://glygen.org/publication/PubMed/35338845" } ] }, { "title": "LAMTOR1 degrades MHC-II via the endocytic in Hepatocellular Carcinoma.", "journal": "Carcinogenesis", "date": "2022-09-07", "authors": "Wu Bo, Wang Qian, Li Bowen, Jiang Meixi", "evidence": [ { "database": "RefSeq", "id": "NP_060377", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060377" } ], "reference": [ { "type": "PubMed", "id": "36070764", "url": "https://glygen.org/publication/PubMed/36070764" } ] }, { "title": "USP32-regulated LAMTOR1 ubiquitination impacts mTORC1 activation and autophagy induction.", "journal": "Cell Rep.", "date": "2022", "authors": "Hertel Alexandra, Alves Ludovico Martins, Dutz Henrik, Tascher Georg, Bonn Florian, Kaulich Manuel, Dikic Ivan, Eimer Stefan, Steinberg Florian, Bremm Anja", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "reference": [ { "type": "PubMed", "id": "36476874", "url": "https://glygen.org/publication/PubMed/36476874" } ] }, { "title": "Enzymic properties of different types of human erythrocyte glucose-6-phosphate dehydrogenase, with characterization of two new genetic variants.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Luzzatto L, Afolayan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "5666113", "url": "https://glygen.org/publication/PubMed/5666113" } ] }, { "title": "Guanine nucleotide exchange catalyzed by dbl oncogene product.", "journal": "Methods in enzymology", "date": "1995", "authors": "Zheng Y, Hart MJ, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "7476457", "url": "https://glygen.org/publication/PubMed/7476457" } ] }, { "title": "Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Chuang TH, Xu X, Kaartinen V, Heisterkamp N, Groffen J, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7479768", "url": "https://glygen.org/publication/PubMed/7479768" } ] }, { "title": "Cloning of a novel family of mammalian GTP-binding proteins (RagA, RagBs, RagB1) with remote similarity to the Ras-related GTPases.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schurmann A, Brauers A, Massmann S, Becker W, Joost HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9639288", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288" } ], "reference": [ { "type": "PubMed", "id": "7499430", "url": "https://glygen.org/publication/PubMed/7499430" } ] }, { "title": "Identification of a novel protein with GDP dissociation inhibitor activity for the ras-like proteins CDC42Hs and rac I.", "journal": "Genes, chromosomes & cancer", "date": "1993", "authors": "Adra CN, Ko J, Leonard D, Wirth LJ, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "7512369", "url": "https://glygen.org/publication/PubMed/7512369" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system.", "journal": "The EMBO journal", "date": "1995", "authors": "Volinia S, Dhand R, Vanhaesebroeck B, MacDougall LK, Stein R, Zvelebil MJ, Domin J, Panaretou C, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852" } ], "reference": [ { "type": "PubMed", "id": "7628435", "url": "https://glygen.org/publication/PubMed/7628435" } ] }, { "title": "Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Jullien-Flores V, Dorseuil O, Romero F, Letourneur F, Saragosti S, Berger R, Tavitian A, Gacon G, Camonis JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7673236", "url": "https://glygen.org/publication/PubMed/7673236" } ] }, { "title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "7721814", "url": "https://glygen.org/publication/PubMed/7721814" } ] }, { "title": "A role for Rac in Tiam1-induced membrane ruffling and invasion.", "journal": "Nature", "date": "1995", "authors": "Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7753201", "url": "https://glygen.org/publication/PubMed/7753201" } ] }, { "title": "A dual functional signal mediator showing RhoGAP and phospholipase C-delta stimulating activities.", "journal": "The EMBO journal", "date": "1995", "authors": "Homma Y, Emori Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7835339", "url": "https://glygen.org/publication/PubMed/7835339" } ] }, { "title": "Energy transduction by cytochrome complexes in mitochondrial and bacterial respiration: the enzymology of coupling electron transfer reactions to transmembrane proton translocation.", "journal": "Annual review of biochemistry", "date": "1994", "authors": "Trumpower BL, Gennis RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "7979252", "url": "https://glygen.org/publication/PubMed/7979252" } ] }, { "title": "The characterization of gene mutations for human glucose phosphate isomerase deficiency associated with chronic hemolytic anemia.", "journal": "The Journal of clinical investigation", "date": "1994", "authors": "Xu W, Beutler E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "7989588", "url": "https://glygen.org/publication/PubMed/7989588" } ] }, { "title": "Breakpoint cluster region gene product-related domain of n-chimaerin. Discrimination between Rac-binding and GTPase-activating residues by mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ahmed S, Lee J, Wen LP, Zhao Z, Ho J, Best A, Kozma R, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8021274", "url": "https://glygen.org/publication/PubMed/8021274" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "Glucose-6-phosphate dehydrogenase: a `housekeeping` enzyme subject to tissue-specific regulation by hormones, nutrients, and oxidant stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1994", "authors": "Kletzien RF, Harris PK, Foellmi LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "8119488", "url": "https://glygen.org/publication/PubMed/8119488" } ] }, { "title": "p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Burbelo PD, Miyamoto S, Utani A, Brill S, Yamada KM, Hall A, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8537347", "url": "https://glygen.org/publication/PubMed/8537347" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "5'-AMP inhibits dephosphorylation, as well as promoting phosphorylation, of the AMP-activated protein kinase. Studies using bacterially expressed human protein phosphatase-2C alpha and native bovine protein phosphatase-2AC.", "journal": "FEBS letters", "date": "1995", "authors": "Davies SP, Helps NR, Cohen PT, Hardie DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "8549768", "url": "https://glygen.org/publication/PubMed/8549768" } ] }, { "title": "The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH, Streuli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8643598", "url": "https://glygen.org/publication/PubMed/8643598" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "An SH3 domain-containing GTPase-activating protein for Rho and Cdc42 associates with focal adhesion kinase.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Hildebrand JD, Taylor JM, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "8649427", "url": "https://glygen.org/publication/PubMed/8649427" } ] }, { "title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8662891", "url": "https://glygen.org/publication/PubMed/8662891" } ] }, { "title": "IQGAP1, a calmodulin-binding protein with a rasGAP-related domain, is a potential effector for cdc42Hs.", "journal": "The EMBO journal", "date": "1996", "authors": "Hart MJ, Callow MG, Souza B, Polakis P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "8670801", "url": "https://glygen.org/publication/PubMed/8670801" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Brill S, Li S, Lyman CW, Church DM, Wasmuth JJ, Weissbach L, Bernards A, Snijders AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8756646", "url": "https://glygen.org/publication/PubMed/8756646" } ] }, { "title": "Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Hotta K, Tanaka K, Mino A, Kohno H, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "8769096", "url": "https://glygen.org/publication/PubMed/8769096" } ] }, { "title": "Inactivation of acetyl-CoA carboxylase and activation of AMP-activated protein kinase in muscle during exercise.", "journal": "The American journal of physiology", "date": "1996", "authors": "Winder WW, Hardie DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-380972", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972" } ], "reference": [ { "type": "PubMed", "id": "8779952", "url": "https://glygen.org/publication/PubMed/8779952" } ] }, { "title": "Identification of IQGAP as a putative target for the small GTPases, Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kuroda S, Fukata M, Kobayashi K, Nakafuku M, Nomura N, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8798539", "url": "https://glygen.org/publication/PubMed/8798539" } ] }, { "title": "Two GTPases, Cdc42 and Rac, bind directly to a protein implicated in the immunodeficiency disorder Wiskott-Aldrich syndrome.", "journal": "Current biology : CB", "date": "1996", "authors": "Aspenstrom P, Lindberg U, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8805223", "url": "https://glygen.org/publication/PubMed/8805223" } ] }, { "title": "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8810315", "url": "https://glygen.org/publication/PubMed/8810315" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "8939998", "url": "https://glygen.org/publication/PubMed/8939998" } ] }, { "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.", "journal": "Nature", "date": "1997", "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8990121", "url": "https://glygen.org/publication/PubMed/8990121" } ] }, { "title": "Faciogenital dysplasia protein (FGD1) and Vav, two related proteins required for normal embryonic development, are upstream regulators of Rho GTPases.", "journal": "Current biology : CB", "date": "1996", "authors": "Olson MF, Pasteris NG, Gorski JL, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8994827", "url": "https://glygen.org/publication/PubMed/8994827" } ] }, { "title": "Characterization of two alternately spliced forms of phospholipase D1. Activation of the purified enzymes by phosphatidylinositol 4,5-bisphosphate, ADP-ribosylation factor, and Rho family monomeric GTP-binding proteins and protein kinase C-alpha.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hammond SM, Jenco JM, Nakashima S, Cadwallader K, Gu Q, Cook S, Nozawa Y, Prestwich GD, Frohman MA, Morris AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9013646", "url": "https://glygen.org/publication/PubMed/9013646" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "RhoGDIgamma: a GDP-dissociation inhibitor for Rho proteins with preferential expression in brain and pancreas.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Adra CN, Manor D, Ko JL, Zhu S, Horiuchi T, Van Aelst L, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9113980", "url": "https://glygen.org/publication/PubMed/9113980" } ] }, { "title": "Characterization of RAC3, a novel member of the Rho family.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Haataja L, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "9252344", "url": "https://glygen.org/publication/PubMed/9252344" } ] }, { "title": "Characterization of the interactions between the small GTPase Cdc42 and its GTPase-activating proteins and putative effectors. Comparison of kinetic properties of Cdc42 binding to the Cdc42-interactive domains.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhang B, Wang ZX, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9268338", "url": "https://glygen.org/publication/PubMed/9268338" } ] }, { "title": "A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9305890", "url": "https://glygen.org/publication/PubMed/9305890" } ] }, { "title": "WIP, a protein associated with wiskott-aldrich syndrome protein, induces actin polymerization and redistribution in lymphoid cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Ramesh N, Anton IM, Hartwig JH, Geha RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9405671", "url": "https://glygen.org/publication/PubMed/9405671" } ] }, { "title": "Coupling of Ras and Rac guanosine triphosphatases through the Ras exchanger Sos.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Nimnual AS, Yatsula BA, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9438849", "url": "https://glygen.org/publication/PubMed/9438849" } ] }, { "title": "Human myosin-IXb is a mechanochemically active motor and a GAP for rho.", "journal": "Journal of cell science", "date": "1998", "authors": "Post PL, Bokoch GM, Mooseker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9490638", "url": "https://glygen.org/publication/PubMed/9490638" } ] }, { "title": "MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Toure A, Dorseuil O, Morin L, Timmons P, Jegou B, Reibel L, Gacon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9497316", "url": "https://glygen.org/publication/PubMed/9497316" } ] }, { "title": "Oligophrenin-1 encodes a rhoGAP protein involved in X-linked mental retardation.", "journal": "Nature", "date": "1998", "authors": "Billuart P, Bienvenu T, Ronce N, des Portes V, Vinet MC, Zemni R, Roest Crollius H, Carrie A, Fauchereau F, Cherry M, Briault S, Hamel B, Fryns JP, Beldjord C, Kahn A, Moraine C, Chelly J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9582072", "url": "https://glygen.org/publication/PubMed/9582072" } ] }, { "title": "PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.", "journal": "Molecular cell", "date": "1998", "authors": "Manser E, Loo TH, Koh CG, Zhao ZS, Chen XQ, Tan L, Tan I, Leung T, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9659915", "url": "https://glygen.org/publication/PubMed/9659915" } ] }, { "title": "Activation of RhoA and SAPK/JNK signalling pathways by the RhoA-specific exchange factor mNET1.", "journal": "The EMBO journal", "date": "1998", "authors": "Alberts AS, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9670022", "url": "https://glygen.org/publication/PubMed/9670022" } ] }, { "title": "Structural requirements for PAK activation by Rac GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "9705280", "url": "https://glygen.org/publication/PubMed/9705280" } ] }, { "title": "Rapamune (RAPA, rapamycin, sirolimus): mechanism of action immunosuppressive effect results from blockade of signal transduction and inhibition of cell cycle progression.", "journal": "Clinical biochemistry", "date": "1998", "authors": "Sehgal SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-166208", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208" } ], "reference": [ { "type": "PubMed", "id": "9721431", "url": "https://glygen.org/publication/PubMed/9721431" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia.", "journal": "The EMBO journal", "date": "1998", "authors": "Abo A, Qu J, Cammarano MS, Dan C, Fritsch A, Baud V, Belisle B, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9822598", "url": "https://glygen.org/publication/PubMed/9822598" } ] }, { "title": "Phosphorylation-dependent and constitutive activation of Rho proteins by wild-type and oncogenic Vav-2.", "journal": "The EMBO journal", "date": "1998", "authors": "Schuebel KE, Movilla N, Rosa JL, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "9822605", "url": "https://glygen.org/publication/PubMed/9822605" } ] }, { "title": "Dimerization via tandem leucine zippers is essential for the activation of the mitogen-activated protein kinase kinase kinase, MLK-3.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Leung IW, Lassam N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9829970", "url": "https://glygen.org/publication/PubMed/9829970" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP.", "journal": "Nature structural biology", "date": "1998", "authors": "Nassar N, Hoffman GR, Manor D, Clardy JC, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9846874", "url": "https://glygen.org/publication/PubMed/9846874" } ] }, { "title": "Cloning and characterization of GEF-H1, a microtubule-associated guanine nucleotide exchange factor for Rac and Rho GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ren Y, Li R, Zheng Y, Busch H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013406", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406" } ], "reference": [ { "type": "PubMed", "id": "9857026", "url": "https://glygen.org/publication/PubMed/9857026" } ] }, { "title": "PA26, a novel target of the p53 tumor suppressor and member of the GADD family of DNA damage and growth arrest inducible genes.", "journal": "Oncogene", "date": "1999", "authors": "Velasco-Miguel S, Buckbinder L, Jean P, Gelbert L, Talbott R, Laidlaw J, Seizinger B, Kley N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897" } ], "reference": [ { "type": "PubMed", "id": "9926927", "url": "https://glygen.org/publication/PubMed/9926927" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:55004", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:55004", "resource": "KEGG Pathway" }, { "id": "R-HSA-1632852", "name": "Macroautophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1632852", "resource": "Reactome", "description": "Macroautophagy" }, { "id": "R-HSA-165159", "name": "MTOR signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165159", "resource": "Reactome", "description": "MTOR signalling" }, { "id": "R-HSA-166208", "name": "mTORC1-mediated signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166208", "resource": "Reactome", "description": "mTORC1-mediated signalling" }, { "id": "R-HSA-380972", "name": "Energy dependent regulation of mTOR by LKB1-AMPK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380972", "resource": "Reactome", "description": "Energy dependent regulation of mTOR by LKB1-AMPK" }, { "id": "R-HSA-5628897", "name": "TP53 Regulates Metabolic Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5628897", "resource": "Reactome", "description": "TP53 Regulates Metabolic Genes" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-8943724", "name": "Regulation of PTEN gene transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8943724", "resource": "Reactome", "description": "Regulation of PTEN gene transcription" }, { "id": "R-HSA-9013148", "name": "CDC42 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148", "resource": "Reactome", "description": "CDC42 GTPase cycle" }, { "id": "R-HSA-9013149", "name": "RAC1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "resource": "Reactome", "description": "RAC1 GTPase cycle" }, { "id": "R-HSA-9013404", "name": "RAC2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404", "resource": "Reactome", "description": "RAC2 GTPase cycle" }, { "id": "R-HSA-9013406", "name": "RHOQ GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013406", "resource": "Reactome", "description": "RHOQ GTPase cycle" }, { "id": "R-HSA-9013407", "name": "RHOH GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013407", "resource": "Reactome", "description": "RHOH GTPase cycle" }, { "id": "R-HSA-9013408", "name": "RHOG GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408", "resource": "Reactome", "description": "RHOG GTPase cycle" }, { "id": "R-HSA-9013409", "name": "RHOJ GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013409", "resource": "Reactome", "description": "RHOJ GTPase cycle" }, { "id": "R-HSA-9013423", "name": "RAC3 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423", "resource": "Reactome", "description": "RAC3 GTPase cycle" }, { "id": "R-HSA-9639288", "name": "Amino acids regulate mTORC1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9639288", "resource": "Reactome", "description": "Amino acids regulate mTORC1" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6P791-1", "protein_name": "Ragulator complex protein LAMTOR1", "gene_name": "Lamtor1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGCCYSSENEDSDQDQEERKLLLDPSNTPTKALNGAEPSYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP", "length": 161 }, "evidence": [ { "id": "45236115", "url": "http://www.informatics.jax.org/homology/45236115", "database": "MGI" }, { "id": "Q6IAA8", "url": "https://omabrowser.org/oma/group/Q6IAA8/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CQ22-1", "protein_name": "Ragulator complex protein LAMTOR1", "gene_name": "Lamtor1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGCCYSSENEDSDQDREERKLLLDPSSTPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP", "length": 161 }, "evidence": [ { "id": "45236115", "url": "http://www.informatics.jax.org/homology/45236115", "database": "MGI" }, { "id": "Q6IAA8", "url": "https://omabrowser.org/oma/group/Q6IAA8/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "specific granule membrane", "id": "GO:0035579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "ficolin-1-rich granule membrane", "id": "GO:0101003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101003", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "azurophil granule membrane", "id": "GO:0035577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035577", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "Ragulator complex", "id": "GO:0071986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071986", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "regulation of receptor recycling", "id": "GO:0001919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001919", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "regulation of cell growth", "id": "GO:0001558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001558", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "endosome organization", "id": "GO:0007032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007032", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "lysosome organization", "id": "GO:0007040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007040", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "endosomal transport", "id": "GO:0016197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016197", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "positive regulation of TOR signaling", "id": "GO:0032008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032008", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "TORC1 signaling", "id": "GO:0038202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038202", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "cellular response to amino acid stimulus", "id": "GO:0071230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "lysosome localization", "id": "GO:0032418", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032418", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "regulation of cholesterol efflux", "id": "GO:0010874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010874", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" }, { "name": "regulation of cholesterol import", "id": "GO:0060620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060620", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "GTPase binding", "id": "GO:0051020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051020", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "N-terminal myristoylation and palmitoylation mediates its recruitment to lysosome membranes, thereby promoting localization of the Ragulator complex to lysosomes (PubMed:31001086). N-myristoylation by NMT1 is required for palmitoylation at Cys-3 and Cys-4 (PubMed:34999170). May be palmitoylated by ZDHHC3 (PubMed:35893977).", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "34999170", "url": "https://glygen.org/publication/PubMed/34999170" }, { "database": "PubMed", "id": "35893977", "url": "https://glygen.org/publication/PubMed/35893977" }, { "database": "PubMed", "id": "31001086", "url": "https://glygen.org/publication/PubMed/31001086" } ] }, { "annotation": "Ubiquitinated at Lys-60, Lys-103 and Lys-104 by UBE3A, promoting its degradation by the proteasome (PubMed:30020076). Ubiquitination at Lys-20 impairs the association with the lysosomal V-ATPase complex (PubMed:36476874). Deubiquitination at Lys-20 by USP32 promotes the association with the lysosomal V-ATPase complex and subsequent activation of the mTORC1 complex (PubMed:36476874).", "evidence": [ { "database": "UniProtKB", "id": "Q6IAA8", "url": "https://www.uniprot.org/uniprot/Q6IAA8" }, { "database": "PubMed", "id": "36476874", "url": "https://glygen.org/publication/PubMed/36476874" }, { "database": "PubMed", "id": "30020076", "url": "https://glygen.org/publication/PubMed/30020076" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 533 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }