{ "uniprot_canonical_ac": "Q6AXU3-1", "uniprot_ac": "Q6AXU3", "uniprot_id": "I20L2_RAT", "mass": { "chemical_mass": 41311.0, "monoisotopic_mass": 41311.0 }, "refseq": { "ac": "NP_001007742", "name": "interferon-stimulated 20 kDa exonuclease-like 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007742" }, "gene_names": [ { "name": "Isg20l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6AXU3", "id": "Q6AXU3" }, { "name": "Isg20l2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007742", "id": "NP_001007742" } ], "protein_names": [ { "name": "Interferon-stimulated 20 kDa exonuclease-like 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6AXU3" }, { "name": "3.1.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q6AXU3" }, { "name": "interferon-stimulated 20 kDa exonuclease-like 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007742", "id": "NP_001007742" } ], "function": [ { "annotation": "3'-> 5'-exoribonuclease involved in ribosome biogenesis in the processing of the 12S pre-rRNA. Displays a strong specificity for a 3'-end containing a free hydroxyl group (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "common_name": "Rat" } ], "gene": [ { "name": "Isg20l2", "url": "https://www.uniprot.org/uniprot/Q6AXU3", "locus": { "chromosome": "2", "start_pos": 173406614, "end_pos": 173396780, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000011402", "url": "https://www.ensembl.org/id/ENSRNOG00000011402" } ] } } ], "crossref": [ { "id": "ENSRNOG00000011402", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000011402", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06149", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06149", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "361977", "url": "https://www.ncbi.nlm.nih.gov/gene/361977", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR012337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013520", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013520", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047021", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047021", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:361977", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361977", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PCPIVDY", "url": "https://omabrowser.org/oma/group/PCPIVDY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5479236at2759", "url": "http://www.orthodb.org/?query=5479236at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12801", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12801", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12801:SF78", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12801:SF78", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00929", "url": "http://pfam.xfam.org/family/PF00929", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6AXU3", "url": "http://purl.obolibrary.org/obo/PR_Q6AXU3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-6791226", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6791226", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001007742", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007742", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1359413", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1359413", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6GML8", "url": "https://www.uniprot.org/uniprot/A0A8I6GML8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GML8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GML8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6AXU3-1", "url": "https://www.uniprot.org/uniprot/Q6AXU3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTILLNLDFGEPSKKAFGGNAKHQRFVKKRRFLEQKGFLSKKNQPPSKVSKLNSEPPKKGETSRVDSISKILSCLKKKKEAAASKRDSEQSKDKKASLSWLTPAPSKKTDSVVAKIDLLGEFQSALPKPKRRTQKKGSKKPLKKKIATENSTQTQSKDKGSNKKPLKKNAVQNSTQAQPEDKCPKVPQSLPRKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYIRPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVVGHAIHNDYKALQYFHPKSLTRDTSQIPLLNRKADCPENVTLSLKHLTKKLLSRDIQTGLSGHSSVEDAQATLELYKLVEVEWEQHLAQNPPEN", "length": 369, "header": "sp|Q6AXU3-1|I20L2_RAT Isoform 1 of Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus OX=10116 GN=Isg20l2 PE=2 SV=1 CANONICAL=Q6AXU3-1" }, "isoforms": [ { "isoform_ac": "A0A8I6GML8-1", "url": "", "sequence": { "sequence": "MSTILLNLDFGEPSKKAFGGNAKHQRFVKKRRFLEQKGFLSKKNQPPSKVSKLNSEPPKKGETSRVDSISKILSCLKKKKEAAASKRDSEQSKDKKASLSWLTPAPSKKTDSVVAKIDLLGEFQSALPKPKRRTQKKGSKKPLKKKIATENSTQTQSKDKGSNKKPLKKNAVQNSTQAQPEDKCPKVPQSLPRKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYIRPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVVGHAIHNDYKALQYFHPKSLTRDTSQIPLLNRKADCPENVTLSLKHLTKKLLSRDIQVTSLQVPPPTVTQ", "length": 345, "header": "tr|A0A8I6GML8-1|I20L2_RAT Computationally mapped isoform of Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus OX=10116 GN=Isg20l2 PE=2 SV=1 CANONICAL=Q6AXU3-1" }, "locus": { "chromosome": "2", "start_pos": 173405611, "end_pos": 173397911, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000096232.1", "url": "https://www.ensembl.org/id/ENSRNOT00000096232.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097651.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097651.1" } ] } }, { "isoform_ac": "Q6AXU3-1", "url": "", "sequence": { "sequence": "MSTILLNLDFGEPSKKAFGGNAKHQRFVKKRRFLEQKGFLSKKNQPPSKVSKLNSEPPKKGETSRVDSISKILSCLKKKKEAAASKRDSEQSKDKKASLSWLTPAPSKKTDSVVAKIDLLGEFQSALPKPKRRTQKKGSKKPLKKKIATENSTQTQSKDKGSNKKPLKKNAVQNSTQAQPEDKCPKVPQSLPRKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYIRPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVVGHAIHNDYKALQYFHPKSLTRDTSQIPLLNRKADCPENVTLSLKHLTKKLLSRDIQTGLSGHSSVEDAQATLELYKLVEVEWEQHLAQNPPEN", "length": 369, "header": "sp|Q6AXU3-1|I20L2_RAT Isoform 1 of Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus OX=10116 GN=Isg20l2 PE=2 SV=1 CANONICAL=Q6AXU3-1" }, "locus": { "chromosome": "2", "start_pos": 173406137, "end_pos": 173397911, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000015471", "url": "https://www.ensembl.org/id/ENSRNOT00000015471" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000015471", "url": "https://www.ensembl.org/id/ENSRNOP00000015471" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:361977", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361977", "resource": "KEGG Pathway" }, { "id": "R-RNO-6791226", "name": "Major pathway of rRNA processing in the nucleolus and cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6791226", "resource": "Reactome", "description": "Major pathway of rRNA processing in the nucleolus and cytosol" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3U1G5-1", "protein_name": "Interferon-stimulated 20 kDa exonuclease-like 2", "gene_name": "Isg20l2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSTILLNLDFGQPSKKAFGGNAKHQRFVKKRRFLEQKGFLNKKNQPPNKVSKLNSEPPKKGETSRVDGILKILPCPKKKEAAASKRDSERSKDKKAPLSWLTPAPSKKTASVVSKIDLLGEFQSALPKTKSTQKKGSKKKSLKKKIATENSTQAQSKDKGSKKKPLKKNAVPNSTQARSEDKCPTVPQNLPGKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYVLPPCYIVNYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVIGHAIHNDYKALQYFHPKSLTRDTSRIPLLNRKADCPENVTLSLKHLTKKLLSRDIQVGNTGHSSVEDAQATMELYKLVEVEWEQHLAQNPPEN", "length": 368 }, "evidence": [ { "id": "45237151", "url": "http://www.informatics.jax.org/homology/45237151", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H9L3-1", "protein_name": "Interferon-stimulated 20 kDa exonuclease-like 2", "gene_name": "ISG20L2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD", "length": 353 }, "evidence": [ { "id": "45237151", "url": "http://www.informatics.jax.org/homology/45237151", "database": "MGI" }, { "id": "Q6AXU3", "url": "https://omabrowser.org/oma/group/Q6AXU3/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "ribosome biogenesis", "id": "GO:0042254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" }, { "name": "exonuclease activity", "id": "GO:0004527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004527", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" }, { "name": "3'-5'-RNA exonuclease activity", "id": "GO:0000175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000175", "evidence": [ { "database": "UniProtKB", "id": "Q6AXU3", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 174, "end_pos": 176, "annotation": "n_glycosylation_sequon" }, { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 314, "end_pos": 316, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-6791218", "name": "12S pre-rRNA is nucleolytically processed to yield 5.8S rRNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AXU3-1", "Q5FVR4-1" ], "evidence": [ { "id": "R-RNO-6791218", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6791218" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q5FVR4", "gene_name": "Eri1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q5FVR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVR4" } ] } ] }, { "uniprot_ac": "Q6AXU3", "gene_name": "Isg20l2", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q6AXU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXU3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }