{ "uniprot_canonical_ac": "Q6AXT5-1", "uniprot_ac": "Q6AXT5", "uniprot_id": "RAB21_RAT", "mass": { "chemical_mass": 24163.0, "monoisotopic_mass": 24163.0 }, "refseq": { "ac": "NP_001004238", "name": "ras-related protein Rab-21", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004238" }, "gene_names": [ { "name": "Rab21", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q6AXT5", "id": "Q6AXT5" }, { "name": "Rab21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004238", "id": "NP_001004238" } ], "protein_names": [ { "name": "Ras-related protein Rab-21", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q6AXT5" }, { "name": "ras-related protein Rab-21", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004238", "id": "NP_001004238" } ], "function": [ { "annotation": "Small GTPase involved in membrane trafficking control (By similarity). Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general (By similarity). As a result, may regulate cell adhesion and migration (By similarity). During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis (By similarity). Involved in neurite growth (PubMed:19745841). Following SBF2/MTMT13-mediated activation in response to starvation-induced autophagy, binds to and regulates SNARE protein VAMP8 endolysosomal transport required for SNARE-mediated autophagosome-lysosome fusion (By similarity). Modulates protein levels of the cargo receptors TMED2 and TMED10, and required for appropriate Golgi localization of TMED10 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5#function" }, { "database": "PubMed", "id": "19745841", "url": "https://glygen.org/publication/PubMed/19745841" }, { "database": "UniProtKB", "id": "Q9UL25", "url": "https://www.uniprot.org/uniprot/Q9UL25#function" }, { "database": "UniProtKB", "id": "P35282", "url": "https://www.uniprot.org/uniprot/P35282#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Rab21", "url": "https://www.uniprot.org/uniprot/Q6AXT5", "locus": { "chromosome": "7", "start_pos": 50904057, "end_pos": 50928839, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003923", "url": "https://www.ensembl.org/id/ENSRNOG00000003923" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003923", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003923", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04123", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04123", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "299799", "url": "https://www.ncbi.nlm.nih.gov/gene/299799", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041833", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041833", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:299799", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299799", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MHFHTSA", "url": "https://omabrowser.org/oma/group/MHFHTSA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5483572at2759", "url": "http://www.orthodb.org/?query=5483572at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47978:SF52", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47978:SF52", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q6AXT5", "url": "http://purl.obolibrary.org/obo/PR_Q6AXT5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8873719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8876198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001004238", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001004238", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1303150", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303150", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6AXT5-1", "url": "https://www.uniprot.org/uniprot/Q6AXT5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSGSGGCCSSG", "length": 223, "header": "sp|Q6AXT5-1|RAB21_RAT Isoform 1 of Ras-related protein Rab-21 OS=Rattus norvegicus OX=10116 GN=Rab21 PE=2 SV=1 CANONICAL=Q6AXT5-1" }, "isoforms": [ { "isoform_ac": "Q6AXT5-1", "url": "", "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSGSGGCCSSG", "length": 223, "header": "sp|Q6AXT5-1|RAB21_RAT Isoform 1 of Ras-related protein Rab-21 OS=Rattus norvegicus OX=10116 GN=Rab21 PE=2 SV=1 CANONICAL=Q6AXT5-1" }, "locus": { "chromosome": "7", "start_pos": 50928619, "end_pos": 50904651, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000005258", "url": "https://www.ensembl.org/id/ENSRNOT00000005258" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000005258", "url": "https://www.ensembl.org/id/ENSRNOP00000005258" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.", "journal": "EMBO Rep.", "date": "2009", "authors": "Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "reference": [ { "type": "PubMed", "id": "19745841", "url": "https://glygen.org/publication/PubMed/19745841" } ] } ], "pathway": [ { "id": "rno:299799", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299799", "resource": "KEGG Pathway" }, { "id": "R-RNO-8873719", "name": "RAB geranylgeranylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8873719", "resource": "Reactome", "description": "RAB geranylgeranylation" }, { "id": "R-RNO-8876198", "name": "RAB GEFs exchange GTP for GDP on RABs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8876198", "resource": "Reactome", "description": "RAB GEFs exchange GTP for GDP on RABs" } ], "orthologs": [ { "uniprot_canonical_ac": "P35282-1", "protein_name": "Ras-related protein Rab-21", "gene_name": "Rab21", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG", "length": 222 }, "evidence": [ { "id": "45230870", "url": "http://www.informatics.jax.org/homology/45230870", "database": "MGI" }, { "id": "Q6AXT5", "url": "https://omabrowser.org/oma/group/Q6AXT5/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UL25-1", "protein_name": "Ras-related protein Rab-21", "gene_name": "RAB21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG", "length": 225 }, "evidence": [ { "id": "45230870", "url": "http://www.informatics.jax.org/homology/45230870", "database": "MGI" }, { "id": "Q6AXT5", "url": "https://omabrowser.org/oma/group/Q6AXT5/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "Golgi cisterna membrane", "id": "GO:0032580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "cytoplasmic side of plasma membrane", "id": "GO:0009898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "axon cytoplasm", "id": "GO:1904115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904115", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "vesicle membrane", "id": "GO:0012506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012506", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "cytoplasmic side of early endosome membrane", "id": "GO:0098559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098559", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "regulation of axon extension", "id": "GO:0030516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030516", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "anterograde axonal transport", "id": "GO:0008089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008089", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "positive regulation of dendrite morphogenesis", "id": "GO:0050775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050775", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "Rab protein signal transduction", "id": "GO:0032482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032482", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "positive regulation of early endosome to late endosome transport", "id": "GO:2000643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000643", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" }, { "name": "regulation of exocytosis", "id": "GO:0017157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017157", "evidence": [ { "database": "UniProtKB", "id": "Q6AXT5", "url": "https://www.uniprot.org/uniprot/Q6AXT5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 191, "end_pos": 193, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }