{ "uniprot_canonical_ac": "Q68G12-1", "uniprot_ac": "Q68G12", "uniprot_id": "SIAT9_RAT", "mass": { "chemical_mass": 44640.0, "monoisotopic_mass": 44640.0 }, "refseq": { "ac": "NP_112627", "name": "lactosylceramide alpha-2,3-sialyltransferase isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112627" }, "gene_names": [ { "name": "St3gal5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q68G12", "id": "Q68G12" }, { "name": "Siat9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q68G12", "id": "Q68G12" } ], "protein_names": [ { "name": "Lactosylceramide alpha-2,3-sialyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q68G12" }, { "name": "2.4.3.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "Ganglioside GM3 synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "ST3Gal V", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "ST3GalV", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "Sialyltransferase 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q68G12" }, { "name": "lactosylceramide alpha-2,3-sialyltransferase isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112627", "id": "NP_112627" }, { "name": "lactosylceramide alpha-2,3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase; ST3Gal V; ganglioside GM3 synthase; ST3GalV; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112627", "id": "NP_112627" } ], "function": [ { "annotation": "Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose (Gal) of glycosphingolipids forming gangliosides (important molecules involved in the regulation of multiple cellular processes, including cell proliferation and differentiation, apoptosis, embryogenesis, development, and oncogenesis). Mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1), although less preferentially than beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer (LacCer).", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12#function" }, { "database": "UniProtKB", "id": "Q9UNP4", "url": "https://www.uniprot.org/uniprot/Q9UNP4#function" } ] } ], "disease": [ { "disease_id": "DOID:0060470", "recommended_name": { "id": "DOID:0060470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060470", "name": "salt and pepper syndrome", "description": "A syndrome characterized by severe intellectual disability, epilepsy, scoliosis, choreoathetosis, dysmorphic facial features and altered dermal pigmentation that has_material_basis_in homozygous or compound heterozygous mutation in the SIAT9 gene on chromosome 2p11.2." }, "synonyms": [ { "id": "DOID:0060470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060470", "name": "salt & pepper syndrome", "description": "" }, { "id": "DOID:0060470", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060470", "name": "salt-and-pepper syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "GM3 synthase deficiency", "description": "GM3 synthase deficiency is characterized by recurrent seizures (epilepsy) and problems with brain development. Within the first few weeks after birth, affected infants become irritable and develop feeding difficulties and vomiting that prevent them from growing and gaining weight at the usual rate. Seizures begin within the first year of life and worsen over time. Multiple types of seizures are possible, including generalized tonic-clonic seizures (also known as grand mal seizures), which cause muscle rigidity, convulsions, and loss of consciousness. Some affected children also experience prolonged episodes of seizure activity called nonconvulsive status epilepticus. The seizures associated with GM3 synthase deficiency tend to be resistant (refractory) to treatment with antiseizure medications." }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "Amish infantile epilepsy syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "GM3 synthase deficiency", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "SPDRS", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "ST3GAL5-CDG", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "disorder of lactosylceramide alpha-2,3-sialyltransferase activity", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "epilepsy syndrome, infantile-onset symptomatic", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "infantile-onset symptomatic epilepsy syndrome - developmental stagnation - blindness", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "infantile-onset symptomatic epilepsy syndrome-developmental stagnation-blindness syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "lactosylceramide alpha-2,3-sialyltransferase activity disease", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "salt & pepper syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "salt and pepper developmental regression syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "salt-and-pepper syndrome", "description": "" }, { "id": "MONDO:0018274", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018274", "name": "salt and pepper mental retardation syndrome", "description": "" }, { "id": "MIM:609056", "resource": "MIM", "url": "https://www.omim.org/entry/609056", "name": "Salt and pepper developmental regression syndrome", "description": "Salt and pepper developmental regression syndrome" } ], "evidence": [ { "id": "0060470", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060470" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "common_name": "Rat" } ], "gene": [ { "name": "St3gal5", "url": "https://www.uniprot.org/uniprot/Q68G12", "locus": { "chromosome": "4", "start_pos": 104192558, "end_pos": 104134613, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000010284", "url": "https://www.ensembl.org/id/ENSRNOG00000010284" } ] } } ], "crossref": [ { "id": "ENSRNOG00000010284", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000010284", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GT29", "url": "http://www.cazy.org/GT29.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "83505", "url": "https://www.ncbi.nlm.nih.gov/gene/83505", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:83505", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:83505", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TPLHWVD", "url": "https://omabrowser.org/oma/group/TPLHWVD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5404317at2759", "url": "http://www.orthodb.org/?query=5404317at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13713", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13713", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13713:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13713:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00777", "url": "http://pfam.xfam.org/family/PF00777", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q68G12", "url": "http://purl.obolibrary.org/obo/PR_Q68G12", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-4085001", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_112627", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112627", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620875", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620875", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "18417", "url": "https://www.rhea-db.org/rhea/18417", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41776", "url": "https://www.rhea-db.org/rhea/41776", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41780", "url": "https://www.rhea-db.org/rhea/41780", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41784", "url": "https://www.rhea-db.org/rhea/41784", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2K3X7", "url": "https://www.uniprot.org/uniprot/A0A0G2K3X7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K3X7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K3X7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZTQ4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZTQ4-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZTQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68G12-1", "url": "https://www.uniprot.org/uniprot/Q68G12-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH", "length": 387, "header": "sp|Q68G12-1|SIAT9_RAT Isoform 1 of Lactosylceramide alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal5 PE=2 SV=1 CANONICAL=Q68G12-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K3X7-1", "url": "", "sequence": { "sequence": "MRTEAAGGAARRPQKPRSQAAAPACRAMPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH", "length": 414, "header": "tr|A0A0G2K3X7-1|A0A0G2K3X7_RAT Computationally mapped isoform of ST3 beta-galactoside alpha-2,3-sialyltransferase 5 OS=Rattus norvegicus OX=10116 GN=St3gal5 PE=1 SV=2 CANONICAL=Q68G12-1" }, "locus": { "chromosome": "4", "start_pos": 104191592, "end_pos": 104134706, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078793.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078793.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072818.2", "url": "https://www.ensembl.org/id/ENSRNOP00000072818.2" } ] } }, { "isoform_ac": "A0A8I5ZTQ4-1", "url": "", "sequence": { "sequence": "MTTPSMAFLPLPEPRCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH", "length": 361, "header": "tr|A0A8I5ZTQ4-1|A0A8I5ZTQ4_RAT Computationally mapped isoform of ST3 beta-galactoside alpha-2,3-sialyltransferase 5 OS=Rattus norvegicus OX=10116 GN=St3gal5 PE=1 SV=1 CANONICAL=Q68G12-1" }, "locus": { "chromosome": "4", "start_pos": 104191592, "end_pos": 104172045, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000115948.1", "url": "https://www.ensembl.org/id/ENSRNOT00000115948.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082302.1", "url": "https://www.ensembl.org/id/ENSRNOP00000082302.1" } ] } }, { "isoform_ac": "Q68G12-1", "url": "", "sequence": { "sequence": "MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH", "length": 387, "header": "sp|Q68G12-1|SIAT9_RAT Isoform 1 of Lactosylceramide alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal5 PE=2 SV=1 CANONICAL=Q68G12-1" }, "locus": { "chromosome": "4", "start_pos": 104191592, "end_pos": 104168550, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000050249", "url": "https://www.ensembl.org/id/ENSRNOT00000050249" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000042426", "url": "https://www.ensembl.org/id/ENSRNOP00000042426" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "rno:83505", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:83505", "resource": "KEGG Pathway" }, { "id": "R-RNO-4085001", "name": "Sialic acid metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4085001", "resource": "Reactome", "description": "Sialic acid metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "O88829-1", "protein_name": "Lactosylceramide alpha-2,3-sialyltransferase", "gene_name": "St3gal5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MHTEAVGGAARRPQKLRSQAAAPACRAMPSEFTSAKLRSDCSRTSLQWYTRTQHKMRRPSLLIKDICKCTLVAFGVWLLYILILNYTAEECDMKRMHYVDPDRIKRAQSYAQEVLQKECRPRYAKTAMALLFEDRYSINLEPFVQKVPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKACKRCVVVGNGGILHGLELGHALNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDVEYYANDLFVTVLFKSVDFKWLQAMVKNESLPFWVRLFFWKQVAEKVPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGVIAVVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMHWQVMHNVTTETKFLLKLLKEGVVEDLSGGIH", "length": 414 }, "evidence": [ { "id": "45228011", "url": "http://www.informatics.jax.org/homology/45228011", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UNP4-1", "protein_name": "Lactosylceramide alpha-2,3-sialyltransferase", "gene_name": "ST3GAL5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF", "length": 418 }, "evidence": [ { "id": "45228011", "url": "http://www.informatics.jax.org/homology/45228011", "database": "MGI" }, { "id": "Q68G12", "url": "https://omabrowser.org/oma/group/Q68G12/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein glycosylation", "id": "GO:0006486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "lactosylceramide alpha-2,3-sialyltransferase activity", "id": "GO:0047291", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047291", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" }, { "name": "sialyltransferase activity", "id": "GO:0008373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008373", "evidence": [ { "database": "UniProtKB", "id": "Q68G12", "url": "https://www.uniprot.org/uniprot/Q68G12" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" }, { "start_pos": 252, "end_pos": 254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 362, "end_pos": 364, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18417", "name": "", "equation": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q68G12-1", "Q9UNP4-1", "O88829-1" ], "evidence": [ { "id": "18417", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18417" } ] }, { "id": "41776", "name": "", "equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GA2 (d18:1(4E)/18:0) = CMP + ganglioside GM2 (d18:1(4E)/18:0) + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q68G12-1", "Q9UNP4-1", "O88829-1" ], "evidence": [ { "id": "41776", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41776" } ] }, { "id": "41780", "name": "", "equation": "beta-D-Gal-(1<->1')-Cer + CMP-N-acetyl-beta-neuraminate = CMP + H(+) + N-acetyl-alpha-neuraminosyl-(2->3)-beta-D-galactosyl-(1<->1')-ceramide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q68G12-1", "Q9UNP4-1", "O88829-1" ], "evidence": [ { "id": "41780", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41780" } ] }, { "id": "41784", "name": "", "equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GA1 (d18:1(4E)/18:0) = CMP + ganglioside GM1 (d18:1(4E)/18:0) + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q68G12-1", "Q9UNP4-1", "O88829-1" ], "evidence": [ { "id": "41784", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41784" } ] }, { "id": "R-RNO-4084984", "name": "ST3GAL1-6 transfer Neu5Ac to terminal Gal (alpha-2,3 link)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-ALL-4086285" ], "output_participant_list": [ "R-ALL-4086277" ], "enzyme_list": [ "P61131-1", "P61943-1", "Q02734-1", "Q11205-1", "Q68G12-1" ], "evidence": [ { "id": "R-RNO-4084984", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4084984" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-4086277", "participant_name": "Neu5Ac-2,3-Gal-R [Golgi lumen]", "crossref": [ { "id": "75127", "database": "ChEBI", "url": "" }, { "id": "75127", "database": "ChEBI", "url": "" }, { "id": "75127", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-4086285", "participant_name": "Gal-R [Golgi lumen]", "crossref": [ { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" }, { "id": "61248", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O88829", "gene_name": "St3gal5", "activity": [ { "ec_number": "2.4.3.9", "activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+).", "evidence": [ { "id": "O88829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88829" } ] }, { "ec_number": "2.4.3.9", "activity": "", "evidence": [ { "id": "O88829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88829" } ] } ] }, { "uniprot_ac": "P61131", "gene_name": "St3gal4", "activity": [ { "ec_number": "3.6.1.59", "activity": "a 5'-end (N(2),N(2),N(7)-trimethyl 5'-triphosphoguanosine)-(ribonucleoside) in mRNA + H2O = (N(2),N(2),N(7))-trimethyl-GMP + a 5'-end diphospho-ribonucleoside in mRNA + 2 H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "3.6.1.59", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.2", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "P61131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61131" } ] } ] }, { "uniprot_ac": "P61943", "gene_name": "St3gal6", "activity": [ { "ec_number": "2.4.99.-", "activity": "", "evidence": [ { "id": "P61943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61943" } ] } ] }, { "uniprot_ac": "Q02734", "gene_name": "St3gal3", "activity": [ { "ec_number": "2.4.3.6", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734" } ] }, { "ec_number": "2.4.3.6", "activity": "", "evidence": [ { "id": "Q02734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02734" } ] } ] }, { "uniprot_ac": "Q11205", "gene_name": "St3gal2", "activity": [ { "ec_number": "2.4.3.2", "activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] }, { "ec_number": "2.4.3.4", "activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] }, { "ec_number": "2.4.3.4", "activity": "", "evidence": [ { "id": "Q11205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q11205" } ] } ] }, { "uniprot_ac": "Q68G12", "gene_name": "St3gal5", "activity": [ { "ec_number": "2.4.3.9", "activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12" } ] }, { "ec_number": "2.4.3.9", "activity": "", "evidence": [ { "id": "Q68G12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68G12" } ] } ] }, { "uniprot_ac": "Q9UNP4", "gene_name": "ST3GAL5", "activity": [ { "ec_number": "2.4.3.9", "activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+).", "evidence": [ { "id": "Q9UNP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP4" } ] }, { "ec_number": "2.4.3.9", "activity": "", "evidence": [ { "id": "Q9UNP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }