{ "uniprot_canonical_ac": "Q64633-1", "uniprot_ac": "Q64633", "uniprot_id": "UD17_RAT", "mass": { "chemical_mass": 59627.0, "monoisotopic_mass": 59627.0 }, "refseq": {}, "gene_names": [ { "name": "Ugt1a7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q64633", "id": "Q64633" }, { "name": "Ugt1a7c", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q64633", "id": "Q64633" }, { "name": "Ugt1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q64633", "id": "Q64633" } ], "protein_names": [ { "name": "UDP-glucuronosyltransferase 1A7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q64633" }, { "name": "2.4.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "A2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UDP-glucuronosyltransferase 1-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UDP-glucuronosyltransferase 1A7C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UDPGT 1-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UGT1*7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UGT1-07", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UGT1.7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" }, { "name": "UGT1A7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q64633" } ], "function": [ { "annotation": "UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormone epiestradiol. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633#function" }, { "database": "UniProtKB", "id": "Q9HAW7", "url": "https://www.uniprot.org/uniprot/Q9HAW7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ugt1a7", "url": "https://www.uniprot.org/uniprot/Q64633", "locus": {} } ], "crossref": [ { "id": "2.4.1.17", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.17&UniProtAcc=Q64633", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT1", "url": "http://www.cazy.org/GT1.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd03784", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03784", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR002213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035595", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043:SF147", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043:SF147", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00201", "url": "http://pfam.xfam.org/family/PF00201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q64633", "url": "http://purl.obolibrary.org/obo/PR_Q64633", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-156588", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9749641", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "620950", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620950", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "21032", "url": "https://www.rhea-db.org/rhea/21032", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52868", "url": "https://www.rhea-db.org/rhea/52868", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63612", "url": "https://www.rhea-db.org/rhea/63612", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63696", "url": "https://www.rhea-db.org/rhea/63696", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63704", "url": "https://www.rhea-db.org/rhea/63704", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63724", "url": "https://www.rhea-db.org/rhea/63724", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q64633-1", "url": "https://www.uniprot.org/uniprot/Q64633-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAPADVPASLPLGLCLLLASGFGHAGKLLVVPMDGSHWFTMQMVVEKLLPKGHEVVVVVPEVSWQLGKPLNFTVKTYSVSHTQEDLNREFKFFIDSQWKTQQESGVLPLLTSPAQGFFELLFSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEEGSQCPSPPSYVPRPILKLTDTMTFKERVWNLLSYMGEHAFCPSFFKTATDIASEVLQTPVTMTDLFSPVSVWLLRTDFTLELPRPVMPNVIHIGGINCHQRKPVSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTLLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH", "length": 531, "header": "sp|Q64633-1|UD17_RAT Isoform 1 of UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1 CANONICAL=Q64633-1" }, "isoforms": [ { "isoform_ac": "Q64633-1", "url": "", "sequence": { "sequence": "MAPADVPASLPLGLCLLLASGFGHAGKLLVVPMDGSHWFTMQMVVEKLLPKGHEVVVVVPEVSWQLGKPLNFTVKTYSVSHTQEDLNREFKFFIDSQWKTQQESGVLPLLTSPAQGFFELLFSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEEGSQCPSPPSYVPRPILKLTDTMTFKERVWNLLSYMGEHAFCPSFFKTATDIASEVLQTPVTMTDLFSPVSVWLLRTDFTLELPRPVMPNVIHIGGINCHQRKPVSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTLLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH", "length": 531, "header": "sp|Q64633-1|UD17_RAT Isoform 1 of UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1 CANONICAL=Q64633-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 431, "start_aa": "Asn", "end_pos": 431, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn431", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Isolation and sequencing of rat liver bilirubin UDP-glucuronosyltransferase cDNA: possible alternate splicing of a common primary transcript.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1990", "authors": "Sato H., Koiwai O., Tanabe K., Kashiwamata S.", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "reference": [ { "type": "PubMed", "id": "2112380", "url": "https://glygen.org/publication/PubMed/2112380" } ] }, { "title": "Drug-responsive and tissue-specific alternative expression of multiple first exons in rat UDP-glucuronosyltransferase family 1 (UGT1) gene complex.", "journal": "J. Biochem.", "date": "1995", "authors": "Emi Y, Ikushiro S, Iyanagi T", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "reference": [ { "type": "PubMed", "id": "7608130", "url": "https://glygen.org/publication/PubMed/7608130" } ] } ], "pathway": [ { "id": "R-RNO-156588", "name": "Glucuronidation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-156588", "resource": "Reactome", "description": "Glucuronidation" }, { "id": "R-RNO-9749641", "name": "Aspirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9749641", "resource": "Reactome", "description": "Aspirin ADME" }, { "id": "R-RNO-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "estrogen catabolic process", "id": "GO:0006711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006711", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "cellular glucuronidation", "id": "GO:0052695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052695", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "coumarin catabolic process", "id": "GO:0046226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046226", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "aromatic compound catabolic process", "id": "GO:0019439", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019439", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" }, { "name": "glucuronosyltransferase activity", "id": "GO:0015020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015020", "evidence": [ { "database": "UniProtKB", "id": "Q64633", "url": "https://www.uniprot.org/uniprot/Q64633" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 431, "end_pos": 433, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "21032", "name": "", "equation": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08541-1", "P19488-1", "Q64638-1", "Q64550-1", "P08430-1", "P20720-1", "Q62789-1", "Q64633-1", "Q64634-1", "Q64637-1", "P08542-1", "P09875-1", "P36510-1", "P36511-1", "A0A0G2K727-1", "A0A0G2JW02-1", "F1LTB8-1", "F1M3E3-1", "P54855-1", "P16662-1", "Q3SY77-1", "O75310-1", "P19224-1", "Q6NUS8-1", "Q6UWM9-1", "P36537-1", "P06133-1", "Q9BY64-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "P35504-1", "O60656-1", "O75795-1", "P22310-1", "P22309-1", "P0DTE5-1", "P0DTE4-5", "Q8JZZ0-1", "P70691-1", "Q3UP75-1", "Q8BWQ1-1", "Q62452-1", "Q63886-1", "Q6PDD0-1", "P17717-1", "Q64435-1", "Q8R084-1", "Q8VCN3-1", "Q8BJL9-1", "Q8K154-1", "Q80X89-1", "Q3UEP4-1", "Q6ZQM8-1", "D3Z748-1", "K9J7B2-1", "B2RT14-1", "Q9VDA5-1", "Q9VGT4-1", "Q9VGT5-1", "Q9VGS7-1", "Q9VJ46-1", "Q8SYL7-1", "Q9VJ45-1", "Q9W2J3-1", "Q9VJ81-1", "Q9VGT2-1", "Q9VGT8-1", "Q9W2J4-1", "Q9V9X9-1", "Q9VJ47-1", "Q9VGT0-1" ], "evidence": [ { "id": "21032", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21032" } ] }, { "id": "52868", "name": "", "equation": "17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha-estradiol 3-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "P08542-1", "P36510-1", "Q64633-1", "Q64634-1", "Q64637-1", "P36511-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "O75795-1", "P22309-1", "P54855-1", "P0DTE5-1", "P0DTE4-5", "Q63886-1", "Q6PDD0-1", "Q80X89-1", "P17717-1", "Q6ZQM8-1" ], "evidence": [ { "id": "52868", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52868" } ] }, { "id": "63612", "name": "", "equation": "prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64633-1", "Q64634-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63612", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63612" } ] }, { "id": "63696", "name": "", "equation": "SN-38 + UDP-alpha-D-glucuronate = H(+) + SN-38 O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q64633-1", "Q9HAW7-1", "O60656-1", "P22309-1", "Q62452-1", "Q63886-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63696", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63696" } ] }, { "id": "63704", "name": "", "equation": "mycophenolate + UDP-alpha-D-glucuronate = H(+) + mycophenolate 7-O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64633-1", "Q64634-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63704", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63704" } ] }, { "id": "63724", "name": "", "equation": "candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D-glucuronoside + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "Q64633-1", "Q64634-1", "P16662-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63724", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63724" } ] }, { "id": "R-RNO-158546", "name": "UGTs glucuronate APAP to APAP-GlcA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-158604" ], "enzyme_list": [ "P08430-1", "P09875-1", "P36511-1", "Q62789-1", "Q64633-1", "Q64634-1", "P08542-1", "P08541-1", "P19488-1", "Q64550-1", "F1LTB8-1" ], "evidence": [ { "id": "R-RNO-158546", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-158546" } ] }, { "id": "R-RNO-174916", "name": "Formation of N-glucuronides", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P20720-1", "Q64633-1", "Q64634-1", "Q64637-1", "Q64638-1" ], "evidence": [ { "id": "R-RNO-174916", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174916" } ] }, { "id": "R-RNO-174931", "name": "UGTs transfer GlcA from UDP-GlcA to O-centre substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-174384" ], "output_participant_list": [ "R-ALL-158602" ], "enzyme_list": [ "P08430-1", "P09875-1", "P20720-1", "P36510-1", "P36511-1", "Q62789-1", "Q64633-1", "Q64634-1", "Q64637-1", "P08542-1", "P08541-1", "P19488-1", "Q64550-1", "Q64638-1", "F1LTB8-1" ], "evidence": [ { "id": "R-RNO-174931", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174931" } ] }, { "id": "R-RNO-8941701", "name": "UGT1A10 transfers GlcA from UDP-GlcA to GCTN", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-8941723" ], "output_participant_list": [ "R-ALL-8941725" ], "enzyme_list": [ "Q64633-1", "Q64634-1" ], "evidence": [ { "id": "R-RNO-8941701", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8941701" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-158602", "participant_name": "UDP [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "17659", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "HMDB0000295", "database": "HMDB Metabolite", "url": "" }, { "id": "8144064", "database": "PubChem Substance", "url": "" }, { "id": "1749", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "17659", "database": "ChEBI", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "HMDB0000295", "database": "HMDB Metabolite", "url": "" }, { "id": "8144064", "database": "PubChem Substance", "url": "" }, { "id": "1749", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "8144064", "database": "PubChem Substance", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "17659", "database": "ChEBI", "url": "" }, { "id": "1749", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000295", "database": "HMDB Metabolite", "url": "" }, { "id": "000004490939", "database": "ZINC", "url": "" }, { "id": "HMDB0000295", "database": "HMDB Metabolite", "url": "" }, { "id": "8144064", "database": "PubChem Substance", "url": "" }, { "id": "1749", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00015", "database": "COMPOUND", "url": "" }, { "id": "17659", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-158604", "participant_name": "APAP-GlcA [endoplasmic reticulum lumen]", "crossref": [ { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-174384", "participant_name": "UDP-GlcA [endoplasmic reticulum lumen]", "crossref": [ { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-8941723", "participant_name": "GCTN [endoplasmic reticulum lumen]", "crossref": [ { "id": "HMDB0005781", "database": "HMDB Metabolite", "url": "" }, { "id": "34778", "database": "ChEBI", "url": "" }, { "id": "000005999205", "database": "ZINC", "url": "" }, { "id": "C14536", "database": "COMPOUND", "url": "" }, { "id": "C14536", "database": "COMPOUND", "url": "" }, { "id": "000005999205", "database": "ZINC", "url": "" }, { "id": "HMDB0005781", "database": "HMDB Metabolite", "url": "" }, { "id": "34778", "database": "ChEBI", "url": "" }, { "id": "HMDB0005781", "database": "HMDB Metabolite", "url": "" }, { "id": "34778", "database": "ChEBI", "url": "" }, { "id": "000005999205", "database": "ZINC", "url": "" }, { "id": "C14536", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-8941725", "participant_name": "GCTN4OG [endoplasmic reticulum lumen]", "crossref": [ { "id": "133667", "database": "ChEBI", "url": "" }, { "id": "HMDB0041740", "database": "HMDB Metabolite", "url": "" }, { "id": "000095620837", "database": "ZINC", "url": "" }, { "id": "133667", "database": "ChEBI", "url": "" }, { "id": "HMDB0041740", "database": "HMDB Metabolite", "url": "" }, { "id": "000095620837", "database": "ZINC", "url": "" }, { "id": "133667", "database": "ChEBI", "url": "" }, { "id": "HMDB0041740", "database": "HMDB Metabolite", "url": "" }, { "id": "000095620837", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JW02", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] } ] }, { "uniprot_ac": "A0A0G2K727", "gene_name": "ENSRNOG00000065137", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] } ] }, { "uniprot_ac": "B2RT14", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] } ] }, { "uniprot_ac": "D3Z748", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] } ] }, { "uniprot_ac": "F1LTB8", "gene_name": "RGD1559459", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] } ] }, { "uniprot_ac": "F1M3E3", "gene_name": "AC114845.1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] } ] }, { "uniprot_ac": "K9J7B2", "gene_name": "Ugt1a6b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] } ] }, { "uniprot_ac": "O60656", "gene_name": "UGT1A9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] } ] }, { "uniprot_ac": "O75310", "gene_name": "UGT2B11", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] } ] }, { "uniprot_ac": "O75795", "gene_name": "UGT2B17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] } ] }, { "uniprot_ac": "P06133", "gene_name": "UGT2B4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] } ] }, { "uniprot_ac": "P08430", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] } ] }, { "uniprot_ac": "P08541", "gene_name": "Ugt2b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] } ] }, { "uniprot_ac": "P08542", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] } ] }, { "uniprot_ac": "P09875", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] } ] }, { "uniprot_ac": "P0DTE4", "gene_name": "UGT2A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] } ] }, { "uniprot_ac": "P0DTE5", "gene_name": "UGT2A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] } ] }, { "uniprot_ac": "P16662", "gene_name": "UGT2B7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] } ] }, { "uniprot_ac": "P17717", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] } ] }, { "uniprot_ac": "P19224", "gene_name": "UGT1A6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] } ] }, { "uniprot_ac": "P19488", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] } ] }, { "uniprot_ac": "P20720", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] } ] }, { "uniprot_ac": "P22309", "gene_name": "UGT1A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] } ] }, { "uniprot_ac": "P22310", "gene_name": "UGT1A4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] } ] }, { "uniprot_ac": "P35503", "gene_name": "UGT1A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] } ] }, { "uniprot_ac": "P35504", "gene_name": "UGT1A5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] } ] }, { "uniprot_ac": "P36510", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] } ] }, { "uniprot_ac": "P36511", "gene_name": "Ugt2b15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] } ] }, { "uniprot_ac": "P36537", "gene_name": "UGT2B10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] } ] }, { "uniprot_ac": "P54855", "gene_name": "UGT2B15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] } ] }, { "uniprot_ac": "P70691", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] } ] }, { "uniprot_ac": "Q3SY77", "gene_name": "UGT3A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] } ] }, { "uniprot_ac": "Q3UEP4", "gene_name": "Ugt2b36", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] } ] }, { "uniprot_ac": "Q3UP75", "gene_name": "Ugt3a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] } ] }, { "uniprot_ac": "Q62452", "gene_name": "Ugt1a9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] } ] }, { "uniprot_ac": "Q62789", "gene_name": "Ugt2b7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] } ] }, { "uniprot_ac": "Q63886", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] } ] }, { "uniprot_ac": "Q64435", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] } ] }, { "uniprot_ac": "Q64550", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] } ] }, { "uniprot_ac": "Q64633", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] } ] }, { "uniprot_ac": "Q64634", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] } ] }, { "uniprot_ac": "Q64637", "gene_name": "Ugt1a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] } ] }, { "uniprot_ac": "Q64638", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] } ] }, { "uniprot_ac": "Q6NUS8", "gene_name": "UGT3A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] } ] }, { "uniprot_ac": "Q6PDD0", "gene_name": "Ugt2a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] } ] }, { "uniprot_ac": "Q6UWM9", "gene_name": "UGT2A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] } ] }, { "uniprot_ac": "Q6ZQM8", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] } ] }, { "uniprot_ac": "Q80X89", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] } ] }, { "uniprot_ac": "Q8BJL9", "gene_name": "Ugt2b35", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] } ] }, { "uniprot_ac": "Q8BWQ1", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] } ] }, { "uniprot_ac": "Q8JZZ0", "gene_name": "Ugt3a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] } ] }, { "uniprot_ac": "Q8K154", "gene_name": "Ugt2b34", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] } ] }, { "uniprot_ac": "Q8R084", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] } ] }, { "uniprot_ac": "Q8SYL7", "gene_name": "Ugt50B3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] } ] }, { "uniprot_ac": "Q8VCN3", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] } ] }, { "uniprot_ac": "Q9BY64", "gene_name": "UGT2B28", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] } ] }, { "uniprot_ac": "Q9HAW7", "gene_name": "UGT1A7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] } ] }, { "uniprot_ac": "Q9HAW8", "gene_name": "UGT1A10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] } ] }, { "uniprot_ac": "Q9HAW9", "gene_name": "UGT1A8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] } ] }, { "uniprot_ac": "Q9V9X9", "gene_name": "Ugt35D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] } ] }, { "uniprot_ac": "Q9VDA5", "gene_name": "Ugt49B2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] } ] }, { "uniprot_ac": "Q9VGS7", "gene_name": "Ugt303A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] } ] }, { "uniprot_ac": "Q9VGT0", "gene_name": "Ugt35B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] } ] }, { "uniprot_ac": "Q9VGT2", "gene_name": "Ugt35E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] } ] }, { "uniprot_ac": "Q9VGT4", "gene_name": "Ugt302E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] } ] }, { "uniprot_ac": "Q9VGT5", "gene_name": "Ugt302K1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] } ] }, { "uniprot_ac": "Q9VGT8", "gene_name": "Ugt35C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] } ] }, { "uniprot_ac": "Q9VJ45", "gene_name": "Ugt36E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] } ] }, { "uniprot_ac": "Q9VJ46", "gene_name": "Ugt36D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] } ] }, { "uniprot_ac": "Q9VJ47", "gene_name": "Ugt36F1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] } ] }, { "uniprot_ac": "Q9VJ81", "gene_name": "Ugt301D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] } ] }, { "uniprot_ac": "Q9W2J3", "gene_name": "Ugt49C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] } ] }, { "uniprot_ac": "Q9W2J4", "gene_name": "Ugt49B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }