{ "uniprot_canonical_ac": "Q641Z8-1", "uniprot_ac": "Q641Z8", "uniprot_id": "PEF1_RAT", "mass": { "chemical_mass": 30012.0, "monoisotopic_mass": 30012.0 }, "refseq": { "ac": "NP_001007652", "name": "peflin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652" }, "gene_names": [ { "name": "Pef1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q641Z8", "id": "Q641Z8" }, { "name": "Pef1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652", "id": "NP_001007652" }, { "name": "Peflin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652", "id": "NP_001007652" } ], "protein_names": [ { "name": "Peflin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q641Z8" }, { "name": "PEF protein with a long N-terminal hydrophobic domain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q641Z8" }, { "name": "Penta-EF hand domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q641Z8" }, { "name": "peflin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652", "id": "NP_001007652" }, { "name": "penta-EF hand domain-containing protein 1; PEF protein with a long N-terminal hydrophobic domain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652", "id": "NP_001007652" } ], "function": [ { "annotation": "ALG-2 and peflin regulate COPII targeting and secretion in response to calcium signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_001007652", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652" }, { "database": "PubMed", "id": "34762908", "url": "https://glygen.org/publication/PubMed/34762908" } ] }, { "annotation": "Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Its role in the heterodimer formed with PDCD6 is however unclear: some evidence shows that PEF1 and PDCD6 work together and promote association between PDCD6 and SEC31 in presence of calcium. Other reports show that PEF1 dissociates from PDCD6 in presence of calcium, and may act as a negative regulator of PDCD6 (By similarity). Also acts as a negative regulator of ER-Golgi transport; possibly by inhibiting interaction between PDCD6 and SEC31 (PubMed:27276012).", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8#function" }, { "database": "PubMed", "id": "27276012", "url": "https://glygen.org/publication/PubMed/27276012" }, { "database": "UniProtKB", "id": "Q9UBV8", "url": "https://www.uniprot.org/uniprot/Q9UBV8#function" } ] }, { "annotation": "This work identifies for the first time a clear steady state role for a PEF protein in ER-to-Golgi transport-peflin is a negative regulator of transport. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001007652", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652" }, { "database": "PubMed", "id": "27276012", "url": "https://glygen.org/publication/PubMed/27276012" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "common_name": "Rat" } ], "gene": [ { "name": "Pef1", "url": "https://www.uniprot.org/uniprot/Q641Z8", "locus": { "chromosome": "5", "start_pos": 142475067, "end_pos": 142451778, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000013972", "url": "https://www.ensembl.org/id/ENSRNOG00000013972" } ] } } ], "crossref": [ { "id": "ENSRNOG00000013972", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000013972", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16184", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16184", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "297900", "url": "https://www.ncbi.nlm.nih.gov/gene/297900", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q641Z8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q641Z8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:297900", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297900", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YNKSYNP", "url": "https://omabrowser.org/oma/group/YNKSYNP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "318691at2759", "url": "http://www.orthodb.org/?query=318691at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46212", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46212", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46212:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46212:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13202", "url": "http://pfam.xfam.org/family/PF13202", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13405", "url": "http://pfam.xfam.org/family/PF13405", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q641Z8", "url": "http://purl.obolibrary.org/obo/PR_Q641Z8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001007652", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1359536", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1359536", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AA23", "url": "https://www.uniprot.org/uniprot/A0A8I6AA23", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AA23-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AA23-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q641Z8-1", "url": "https://www.uniprot.org/uniprot/Q641Z8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASYPDGQSYPGAAGQVPGPHPGGYYPGPPHGGGQYGSGFPPGGYGAPAPGGPYGYPSAGGTPSGTPGGPYGGGPPGGPYGGGPPGGPYGQAHPSPYGTQPPGPYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCTRSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML", "length": 283, "header": "sp|Q641Z8-1|PEF1_RAT Isoform 1 of Peflin OS=Rattus norvegicus OX=10116 GN=Pef1 PE=2 SV=1 CANONICAL=Q641Z8-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AA23-1", "url": "", "sequence": { "sequence": "SAVLSFHLSSCSCLFFLQSYPGAAGQVPGPHPGGYYPGPPHGGGQYGSGFPPGGYGAPAPGGPYGYPSAGGTPSGTPGGPYGGGPPGGPYGGGPPGGPYGQAHPSPYGTQPPGPYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCTRSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML", "length": 293, "header": "tr|A0A8I6AA23-1|PEF1_RAT Computationally mapped isoform of Peflin OS=Rattus norvegicus OX=10116 GN=Pef1 PE=2 SV=1 CANONICAL=Q641Z8-1" }, "locus": { "chromosome": "5", "start_pos": 142474424, "end_pos": 142468168, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000119178.1", "url": "https://www.ensembl.org/id/ENSRNOT00000119178.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000090673.1", "url": "https://www.ensembl.org/id/ENSRNOP00000090673.1" } ] } }, { "isoform_ac": "Q641Z8-1", "url": "", "sequence": { "sequence": "MASYPDGQSYPGAAGQVPGPHPGGYYPGPPHGGGQYGSGFPPGGYGAPAPGGPYGYPSAGGTPSGTPGGPYGGGPPGGPYGGGPPGGPYGQAHPSPYGTQPPGPYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCTRSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML", "length": 283, "header": "sp|Q641Z8-1|PEF1_RAT Isoform 1 of Peflin OS=Rattus norvegicus OX=10116 GN=Pef1 PE=2 SV=1 CANONICAL=Q641Z8-1" }, "locus": { "chromosome": "5", "start_pos": 142474424, "end_pos": 142451803, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000018742", "url": "https://www.ensembl.org/id/ENSRNOT00000018742" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000018742", "url": "https://www.ensembl.org/id/ENSRNOP00000018742" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Penta-EF-Hand protein peflin is a negative regulator of ER-to-Golgi transport.", "journal": "PLoS ONE", "date": "2016", "authors": "Rayl M, Truitt M, Held A, Sargeant J, Thorsen K, Hay JC", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" }, { "database": "RefSeq", "id": "NP_001007652", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652" } ], "reference": [ { "type": "PubMed", "id": "27276012", "url": "https://glygen.org/publication/PubMed/27276012" } ] }, { "title": "ALG-2 and peflin regulate COPII targeting and secretion in response to calcium signaling.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Sargeant J, Seiler DK, Costain T, Madreiter-Sokolowski CT, Gordon DE, Peden AA, Malli R, Graier WF, Hay JC", "evidence": [ { "database": "RefSeq", "id": "NP_001007652", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007652" } ], "reference": [ { "type": "PubMed", "id": "34762908", "url": "https://glygen.org/publication/PubMed/34762908" } ] } ], "pathway": [ { "id": "rno:297900", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297900", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BFY6-1", "protein_name": "Peflin", "gene_name": "Pef1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASYPNGQSCPGAAGQVPGVPPGGYYPGPPHGGGQYGSGLPPGGGYGAPAPGGPYGYPSAGGVPSGTPSGPYGGIPPGGPYGQLPPGGPYGTQPGHYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSSFNDETCLMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGYNLSPQFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML", "length": 275 }, "evidence": [ { "id": "45233031", "url": "http://www.informatics.jax.org/homology/45233031", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UBV8-1", "protein_name": "Peflin", "gene_name": "PEF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML", "length": 284 }, "evidence": [ { "id": "45233031", "url": "http://www.informatics.jax.org/homology/45233031", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "neural crest formation", "id": "GO:0014029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014029", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "response to calcium ion", "id": "GO:0051592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051592", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "neural crest cell development", "id": "GO:0014032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014032", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "COPII vesicle coating", "id": "GO:0048208", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048208", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "positive regulation of protein monoubiquitination", "id": "GO:1902527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902527", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "endoplasmic reticulum to Golgi vesicle-mediated transport", "id": "GO:0006888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006888", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "ubiquitin ligase-substrate adaptor activity", "id": "GO:1990756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990756", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "Cul3-RING ubiquitin ligase complex", "id": "GO:0031463", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031463", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "COPII vesicle coat", "id": "GO:0030127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030127", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 146, "end_pos": 148, "annotation": "n_glycosylation_sequon" }, { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated by the BCR(KLHL12) E3 ubiquitin ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "Q641Z8", "url": "https://www.uniprot.org/uniprot/Q641Z8" }, { "database": "PubMed", "id": "Q9UBV8", "url": "https://glygen.org/publication/PubMed/Q9UBV8" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }