{ "uniprot_canonical_ac": "Q641W3-1", "uniprot_ac": "Q641W3", "uniprot_id": "NUFP1_RAT", "mass": { "chemical_mass": 55090.0, "monoisotopic_mass": 55090.0 }, "refseq": { "ac": "NP_001007759", "name": "FMR1-interacting protein NUFIP1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007759" }, "gene_names": [ { "name": "Nufip1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q641W3", "id": "Q641W3" }, { "name": "Nufip1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007759", "id": "NP_001007759" } ], "protein_names": [ { "name": "FMR1-interacting protein NUFIP1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q641W3" }, { "name": "FMR1-interacting protein NUFIP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007759", "id": "NP_001007759" }, { "name": "Nuclear FMRP-interacting protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q641W3" }, { "name": "nuclear FMRP-interacting protein 1; NUFIP1, FMR1 interacting protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007759", "id": "NP_001007759" } ], "function": [ { "annotation": "Binds RNA.", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "common_name": "Rat" } ], "gene": [ { "name": "Nufip1", "url": "https://www.uniprot.org/uniprot/Q641W3", "locus": { "chromosome": "15", "start_pos": 51460310, "end_pos": 51429549, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000001033", "url": "https://www.ensembl.org/id/ENSRNOG00000001033" } ] } } ], "crossref": [ { "id": "ENSRNOG00000001033", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000001033", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "364430", "url": "https://www.ncbi.nlm.nih.gov/gene/364430", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019496", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019496", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039136", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039136", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:364430", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:364430", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VKHSYFP", "url": "https://omabrowser.org/oma/group/VKHSYFP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "57083at2759", "url": "http://www.orthodb.org/?query=57083at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13309", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13309", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13309:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13309:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10453", "url": "http://pfam.xfam.org/family/PF10453", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q641W3", "url": "http://purl.obolibrary.org/obo/PR_Q641W3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001007759", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007759", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1359440", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1359440", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q641W3-1", "url": "https://www.uniprot.org/uniprot/Q641W3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEPTPAGWPSAPELTPAPGTPSEAAPPQDNWVYWAMLPPPPPPLSSPVAGTEPCQKEQPHVEPQPTSGAFPPFDAQILPAAQPPFDAQAPPDGQSQFNDQQAWNFQASTPWYWGLSPNGFPTYNTSFHSPATHSYFPQSYANYNDFNLPQNRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDIHMSEHKKCPEVDCSFSAHEKIVQFHWRNMHAPGMKKIKLDTPEDIARWREERRKNYPTLANIERKKLLQLEKEKRGEVLTTTQYGKMKGMSRHSQMAKIRSPGKHYKWKSGGARQRAVLGLGNRARDLKPEIPTKVNVDPLGVLIHSDSESDKDEKSQRAIVPKEVTPALCSLMSSYGNVSGSESEPEEAPIKTEAEVLAENRVLPSSPPKSPRHNVRTTARTVLRAKWKAQRSGLRKITLKQKKSPCHPLFEPRTRHPHLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLTAGSVKTEDV", "length": 486, "header": "sp|Q641W3-1|NUFP1_RAT Isoform 1 of FMR1-interacting protein NUFIP1 OS=Rattus norvegicus OX=10116 GN=Nufip1 PE=1 SV=1 CANONICAL=Q641W3-1" }, "isoforms": [ { "isoform_ac": "Q641W3-1", "url": "", "sequence": { "sequence": "MAEPTPAGWPSAPELTPAPGTPSEAAPPQDNWVYWAMLPPPPPPLSSPVAGTEPCQKEQPHVEPQPTSGAFPPFDAQILPAAQPPFDAQAPPDGQSQFNDQQAWNFQASTPWYWGLSPNGFPTYNTSFHSPATHSYFPQSYANYNDFNLPQNRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDIHMSEHKKCPEVDCSFSAHEKIVQFHWRNMHAPGMKKIKLDTPEDIARWREERRKNYPTLANIERKKLLQLEKEKRGEVLTTTQYGKMKGMSRHSQMAKIRSPGKHYKWKSGGARQRAVLGLGNRARDLKPEIPTKVNVDPLGVLIHSDSESDKDEKSQRAIVPKEVTPALCSLMSSYGNVSGSESEPEEAPIKTEAEVLAENRVLPSSPPKSPRHNVRTTARTVLRAKWKAQRSGLRKITLKQKKSPCHPLFEPRTRHPHLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLTAGSVKTEDV", "length": 486, "header": "sp|Q641W3-1|NUFP1_RAT Isoform 1 of FMR1-interacting protein NUFIP1 OS=Rattus norvegicus OX=10116 GN=Nufip1 PE=1 SV=1 CANONICAL=Q641W3-1" }, "locus": { "chromosome": "15", "start_pos": 51460127, "end_pos": 51429579, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000001366", "url": "https://www.ensembl.org/id/ENSRNOT00000001366" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000001366", "url": "https://www.ensembl.org/id/ENSRNOP00000001366" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 331, "end_pos": 331, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "site_lbl": "Ser331" }, { "start_pos": 333, "end_pos": 333, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "site_lbl": "Ser333" }, { "start_pos": 335, "end_pos": 335, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "site_lbl": "Ser335" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "site_lbl": "Ser396" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:364430", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:364430", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9QXX8-1", "protein_name": "FMR1-interacting protein NUFIP1", "gene_name": "Nufip1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEPAPAVWPSAPDLTPAPGTPSEAAPPRDNWVYWAMLPPPPPPLSSPVAGSEQSRKGQPHVLPQPPSGALPPFDAQILPAAQPPFDAQAPPDAQSQFSGQQAWNLQASTPWYWGLSPNGFSTYHTSYQSPVTHSYFPRSHDAKFNLPQNRKQKTKKRKEPVFHFFCDTCDRGFKNQEKYDTHMSEHTKCPEVDCSFSAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLQLEKAKRGEVLTTTQYGKMKGMSRHSQMAKIRSPGKHHKWRRGGARQRAVVGLGNHARDSKPEVPSKANVDPLGALIHSDSESDKEEKAQRTVVPKEVTPALCSLMSSYGDVSGSDSEPEEAPIKTEAEVLAENHVLHSSPPKSPKQNVQTTGRTVSRSKWENQRNGLRKISLKRKKSHCHPLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLNTDSVKTEEV", "length": 484 }, "evidence": [ { "id": "45238850", "url": "http://www.informatics.jax.org/homology/45238850", "database": "MGI" }, { "id": "Q641W3", "url": "https://omabrowser.org/oma/group/Q641W3/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UHK0-1", "protein_name": "FMR1-interacting protein NUFIP1", "gene_name": "NUFIP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEPTSDFETPIGWHASPELTPTLGPLSDTAPPRDSWMFWAMLPPPPPPLTSSLPAAGSKPSSESQPPMEAQSLPGAPPPFDAQILPGAQPPFDAQSPLDSQPQPSGQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV", "length": 495 }, "evidence": [ { "id": "45238850", "url": "http://www.informatics.jax.org/homology/45238850", "database": "MGI" }, { "id": "Q641W3", "url": "https://omabrowser.org/oma/group/Q641W3/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "perichromatin fibrils", "id": "GO:0005726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005726", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "transcription elongation factor complex", "id": "GO:0008023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "presynaptic active zone", "id": "GO:0048786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048786", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "nuclear matrix", "id": "GO:0016363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "pre-snoRNP complex", "id": "GO:0070761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070761", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "protein-macromolecule adaptor activity", "id": "GO:0030674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030674", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "ATPase binding", "id": "GO:0051117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051117", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "snoRNA binding", "id": "GO:0030515", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030515", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" }, { "name": "box C/D snoRNP assembly", "id": "GO:0000492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000492", "evidence": [ { "database": "UniProtKB", "id": "Q641W3", "url": "https://www.uniprot.org/uniprot/Q641W3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }