{ "uniprot_canonical_ac": "Q640M6-1", "uniprot_ac": "Q640M6", "uniprot_id": "GDPD5_MOUSE", "mass": { "chemical_mass": 68890.0, "monoisotopic_mass": 68890.0 }, "refseq": { "ac": "NP_958740", "name": "glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, "gene_names": [ { "name": "Gdpd5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q640M6", "id": "Q640M6" }, { "name": "Gde2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q640M6", "id": "Q640M6" } ], "protein_names": [ { "name": "Glycerophosphodiester phosphodiesterase domain-containing protein 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q640M6" }, { "name": "3.1.4.11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q640M6" }, { "name": "3.1.4.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q640M6" }, { "name": "Glycerophosphocholine phosphodiesterase GDPD5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q640M6" }, { "name": "Glycerophosphodiester phosphodiesterase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q640M6" }, { "name": "Phosphoinositide phospholipase C GDPD5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q640M6" }, { "name": "glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740", "id": "NP_958740" }, { "name": "glycerophosphodiester phosphodiesterase domain-containing protein 5; glycerophosphodiester phosphodiesterase 2; phosphoinositide phospholipase C GDPD5; glycerophosphocholine phosphodiesterase GDPD5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740", "id": "NP_958740" } ], "function": [ { "annotation": "Data suggest that neuronal GDE2 controls motor neuron subtype diversity through a non-cell-autonomous feedback mechanism that directly regulates progenitor cell differentiation.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "21943603", "url": "https://glygen.org/publication/PubMed/21943603" } ] }, { "annotation": "GDE2 expression in oligodendroglia regulates the pace of oligodendrocyte maturation.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "33095500", "url": "https://glygen.org/publication/PubMed/33095500" } ] }, { "annotation": "GDE2 is essential for neuronal survival in the postnatal mammalian spinal cord Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "28103900", "url": "https://glygen.org/publication/PubMed/28103900" } ] }, { "annotation": "GDE2-Dependent Activation of Canonical Wnt Signaling in Neurons Regulates Oligodendrocyte Maturation.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "32375055", "url": "https://glygen.org/publication/PubMed/32375055" } ] }, { "annotation": "GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte glycerophosphocholine.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "18667693", "url": "https://glygen.org/publication/PubMed/18667693" } ] }, { "annotation": "Glycerophosphodiester phosphodiesterase that promotes neurite formation and drives spinal motor neuron differentiation (PubMed:17275818, PubMed:18667693). Mediates the cleavage of glycosylphosphatidylinositol (GPI) anchor of target proteins: removes the GPI-anchor of RECK, leading to release RECK from the plasma membrane (By similarity). May contribute to the osmotic regulation of cellular glycerophosphocholine (PubMed:18667693).", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6#function" }, { "database": "PubMed", "id": "18667693", "url": "https://glygen.org/publication/PubMed/18667693" }, { "database": "PubMed", "id": "17275818", "url": "https://glygen.org/publication/PubMed/17275818" }, { "database": "UniProtKB", "id": "Q3KTM2", "url": "https://www.uniprot.org/uniprot/Q3KTM2#function" } ] }, { "annotation": "Study identified the antioxidant enzyme Prdx1 as an interactor of GDE2 and uncover a developmental role for Prdx1 in regulating neuronal differentiation in the spinal cord.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "19766572", "url": "https://glygen.org/publication/PubMed/19766572" } ] }, { "annotation": "These results demonstrate that GDE2 expression during neuronal differentiation plays an important role for growing neurites.", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" }, { "database": "PubMed", "id": "17275818", "url": "https://glygen.org/publication/PubMed/17275818" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388930989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388930989" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 374, "end_pos": 374, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->YVT).", "chr_id": "7", "chr_pos": "99103162", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N374", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gdpd5", "url": "https://www.uniprot.org/uniprot/Q640M6", "locus": { "chromosome": "7", "start_pos": 99111084, "end_pos": 99030621, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000035314", "url": "https://www.ensembl.org/id/ENSMUSG00000035314" } ] } } ], "crossref": [ { "id": "ENSMUSG00000035314", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000035314", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.4.44", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.4.44&UniProtAcc=Q640M6", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "3.1.4.46", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.4.46&UniProtAcc=Q640M6", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "233552", "url": "https://www.ncbi.nlm.nih.gov/gene/233552", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0005614", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0005614", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR017946", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017946", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:233552", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:233552", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2686926", "url": "http://www.informatics.jax.org/marker/MGI:2686926", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CKHCRYR", "url": "https://omabrowser.org/oma/group/CKHCRYR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "203377at2759", "url": "http://www.orthodb.org/?query=203377at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23344", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23344", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23344:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23344:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03009", "url": "http://pfam.xfam.org/family/PF03009", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q640M6", "url": "http://purl.obolibrary.org/obo/PR_Q640M6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16061", "url": "https://www.rhea-db.org/rhea/16061", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "33179", "url": "https://www.rhea-db.org/rhea/33179", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A140LHD5", "url": "https://www.uniprot.org/uniprot/A0A140LHD5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LHD5-1", "url": "https://www.uniprot.org/uniprot/A0A140LHD5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LIN1", "url": "https://www.uniprot.org/uniprot/A0A140LIN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LIN1-1", "url": "https://www.uniprot.org/uniprot/A0A140LIN1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1STK0", "url": "https://www.uniprot.org/uniprot/A0A1L1STK0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1L1STK0-1", "url": "https://www.uniprot.org/uniprot/A0A1L1STK0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q640M6-1", "url": "https://www.uniprot.org/uniprot/Q640M6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNLHWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAMLNWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLRDPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIANLRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKTVTEQSGH", "length": 607, "header": "sp|Q640M6-1|GDPD5_MOUSE Isoform 1 of Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1 CANONICAL=Q640M6-1" }, "isoforms": [ { "isoform_ac": "A0A140LHD5-1", "url": "", "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAG", "length": 103, "header": "tr|A0A140LHD5-1|GDPD5_MOUSE Computationally mapped isoform of Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=2 CANONICAL=Q640M6-1" }, "locus": { "chromosome": "7", "start_pos": 99090466, "end_pos": 99073320, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000208800.2", "url": "https://www.ensembl.org/id/ENSMUST00000208800.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146372.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146372.2" } ] } }, { "isoform_ac": "A0A140LIN1-1", "url": "", "sequence": { "sequence": "MVRHQPLQYYEPQLC", "length": 15, "header": "tr|A0A140LIN1-1|GDPD5_MOUSE Computationally mapped isoform of Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=2 CANONICAL=Q640M6-1" }, "locus": { "chromosome": "7", "start_pos": 99073364, "end_pos": 99073320, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000207530.2", "url": "https://www.ensembl.org/id/ENSMUST00000207530.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146887.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146887.2" } ] } }, { "isoform_ac": "A0A1L1STK0-1", "url": "", "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNLHWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAMLNWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLRDPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIANLRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQNYHLIRWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKTVTEQSGH", "length": 612, "header": "tr|A0A1L1STK0-1|A0A1L1STK0_MOUSE Computationally mapped isoform of Glycerophosphodiester phosphodiesterase domain containing 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1 CANONICAL=Q640M6-1" }, "locus": { "chromosome": "7", "start_pos": 99109317, "end_pos": 99073320, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000213887.2", "url": "https://www.ensembl.org/id/ENSMUST00000213887.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000150361.2", "url": "https://www.ensembl.org/id/ENSMUSP00000150361.2" } ] } }, { "isoform_ac": "Q640M6-1", "url": "", "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNLHWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAMLNWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLRDPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIANLRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKTVTEQSGH", "length": 607, "header": "sp|Q640M6-1|GDPD5_MOUSE Isoform 1 of Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1 CANONICAL=Q640M6-1" }, "locus": { "chromosome": "7", "start_pos": 99109317, "end_pos": 99073320, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000037528", "url": "https://www.ensembl.org/id/ENSMUST00000037528" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000036175", "url": "https://www.ensembl.org/id/ENSMUSP00000036175" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 301, "start_aa": "Asn", "end_pos": 301, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn301", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 336, "start_aa": "Asn", "end_pos": 336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn336", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 352, "start_aa": "Asn", "end_pos": 352, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn352", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 448, "start_aa": "Asn", "end_pos": 448, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn448", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Isolation and characterization of two serpentine membrane proteins containing glycerophosphodiester phosphodiesterase, GDE2 and GDE6.", "journal": "Gene", "date": "2004", "authors": "Kato N., Fujioka Y., Nogusa Y., Yanaka N., Komatsu R.", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "reference": [ { "type": "PubMed", "id": "15276213", "url": "https://glygen.org/publication/PubMed/15276213" } ] }, { "title": "Involvement of membrane protein GDE2 in retinoic acid-induced neurite formation in Neuro2A cells.", "journal": "FEBS Lett.", "date": "2007", "authors": "Yanaka N, Nogusa Y, Fujioka Y, Yamashita Y, Kato N", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" }, { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "17275818", "url": "https://glygen.org/publication/PubMed/17275818" } ] }, { "title": "GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte GPC.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Gallazzini M, Ferraris JD, Burg MB", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" }, { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "18667693", "url": "https://glygen.org/publication/PubMed/18667693" } ] }, { "title": "The antioxidant enzyme Prdx1 controls neuronal differentiation by thiol-redox-dependent activation of GDE2.", "journal": "Cell", "date": "2009", "authors": "Yan Y, Sabharwal P, Rao M, Sockanathan S", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "19766572", "url": "https://glygen.org/publication/PubMed/19766572" } ] }, { "title": "GDE2 regulates subtype-specific motor neuron generation through inhibition of Notch signaling.", "journal": "Neuron", "date": "2011", "authors": "Sabharwal P, Lee C, Park S, Rao M, Sockanathan S", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "21943603", "url": "https://glygen.org/publication/PubMed/21943603" } ] }, { "title": "GDE2 is essential for neuronal survival in the postnatal mammalian spinal cord.", "journal": "Molecular neurodegeneration", "date": "2017", "authors": "Cave C, Park S, Rodriguez M, Nakamura M, Hoke A, Pletnikov M, Sockanathan S", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "28103900", "url": "https://glygen.org/publication/PubMed/28103900" } ] }, { "title": "GDE2-Dependent Activation of Canonical Wnt Signaling in Neurons Regulates Oligodendrocyte Maturation.", "journal": "Cell reports", "date": "2020", "authors": "Choi BR, Cave C, Na CH, Sockanathan S", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "32375055", "url": "https://glygen.org/publication/PubMed/32375055" } ] }, { "title": "GDE2 expression in oligodendroglia regulates the pace of oligodendrocyte maturation.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2021", "authors": "Choi BR, Dobrowolski M, Sockanathan S", "evidence": [ { "database": "RefSeq", "id": "NP_958740", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_958740" } ], "reference": [ { "type": "PubMed", "id": "33095500", "url": "https://glygen.org/publication/PubMed/33095500" } ] } ], "pathway": [ { "id": "mmu:233552", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:233552", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "G3V9L7-1", "protein_name": "Glycerophosphodiester phosphodiesterase domain containing 5", "gene_name": "Gdpd5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLYFWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTTAAAFTYIAGLLVLALCHIAVGQQMNLHWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLVPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEQVFPELARRPAAMLNWTSLQRLNAGQWFLKTDPFWTASSLSPSDHREVENQSICSLAELLELAKGNATLLLNLRDPPHDHPYRGSFLNITLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIASLRRGHIQKLNLHYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANSTVTPMGPQSAGSRAKTFTEQGGH", "length": 605 }, "evidence": [ { "id": "45238130", "url": "http://www.informatics.jax.org/homology/45238130", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8WTR4-1", "protein_name": "Glycerophosphodiester phosphodiesterase domain-containing protein 5", "gene_name": "GDPD5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLYFWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASMLNWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLRDPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVASLRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHALSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR", "length": 605 }, "evidence": [ { "id": "45238130", "url": "http://www.informatics.jax.org/homology/45238130", "database": "MGI" }, { "id": "Q640M6", "url": "https://omabrowser.org/oma/group/Q640M6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "positive regulation of neuron differentiation", "id": "GO:0045666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045666", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "spinal cord motor neuron differentiation", "id": "GO:0021522", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021522", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "negative regulation of Notch signaling pathway", "id": "GO:0045746", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045746", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "cerebral cortex neuron differentiation", "id": "GO:0021895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021895", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "regulation of timing of cell differentiation", "id": "GO:0048505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048505", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "perinuclear endoplasmic reticulum", "id": "GO:0097038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097038", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "phosphoric diester hydrolase activity", "id": "GO:0008081", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008081", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "phosphatidylinositol phospholipase C activity", "id": "GO:0004435", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004435", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "glycerophosphodiester phosphodiesterase activity", "id": "GO:0008889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008889", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" }, { "name": "glycerophosphocholine phosphodiesterase activity", "id": "GO:0047389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047389", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 336, "end_pos": 338, "annotation": "n_glycosylation_sequon" }, { "start_pos": 352, "end_pos": 354, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 448, "end_pos": 450, "annotation": "n_glycosylation_sequon" }, { "start_pos": 583, "end_pos": 585, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Intramolecular disulfide bond between Cys-25 and Cys-571 is reduced by PRDX1.", "evidence": [ { "database": "UniProtKB", "id": "Q640M6", "url": "https://www.uniprot.org/uniprot/Q640M6" }, { "database": "PubMed", "id": "Q3KTM2", "url": "https://glygen.org/publication/PubMed/Q3KTM2" } ] } ], "interactions": [], "reactions": [ { "id": "16061", "name": "", "equation": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q80VJ4-1", "Q9NPB8-1", "Q8WTR4-1", "Q8C0L9-1", "Q640M6-1", "Q02979-1" ], "evidence": [ { "id": "16061", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16061" } ] }, { "id": "33179", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5FX52-1", "Q62711-1", "O89040-1", "P10688-1", "P10686-1", "P10687-1", "P24135-1", "Q99JE6-1", "Q99P84-1", "Q9QW07-1", "A0A096MJW8-1", "Q62688-1", "F1M324-1", "D4A978-1", "A0A8I5ZPH5-1", "Q9UPR0-1", "Q15111-1", "Q86YW0-1", "Q9NQ66-1", "P16885-1", "P19174-1", "O75038-1", "Q8WTR4-1", "Q9BRC7-1", "Q9P212-1", "Q4KWH8-1", "Q8N3E9-1", "Q01970-1", "Q15147-1", "Q00722-1", "P51178-1", "Q8K4S1-1", "Q640M6-1", "Q62077-1", "Q8K2J0-1", "Q8K4D7-1", "Q8K3R3-1", "Q8R3B1-1", "A2AP18-1", "A3KGF7-1", "P51432-1", "Q9Z1B3-1", "Q8CIH5-1", "Q4KWH5-1", "Q91UZ1-1", "P32383-1", "Q02158-1", "P25455-3", "P13217-1", "Q9VXH3-1" ], "evidence": [ { "id": "33179", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33179" } ] }, { "id": "R-MMU-6814137", "name": "Gdpd5 hydrolyzes GPCho", "equation": "", "summary": "Mouse enzyme Gdpd5 (Glycerophosphodiester phosphodiesterase domain-containing protein 5; Gde2) catalyzes the hydrolysis of GPCho (glycero-3-phosphocholine) to G3P (glycerol-3-phosphate) and Cho (choline). The protein co-localizes with endoplasmic reticulum marker proteins (Gallazzini et al. 2008).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q640M6-1" ], "evidence": [ { "id": "R-MMU-6814137", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6814137" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A096MJW8", "gene_name": "Plch1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "A0A096MJW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A096MJW8" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "A0A096MJW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A096MJW8" } ] } ] }, { "uniprot_ac": "A0A8I5ZPH5", "gene_name": "Plch2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "A0A8I5ZPH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPH5" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "A0A8I5ZPH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPH5" } ] } ] }, { "uniprot_ac": "A2AP18", "gene_name": "Plch2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "A2AP18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AP18" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "A2AP18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AP18" } ] } ] }, { "uniprot_ac": "A3KGF7", "gene_name": "Plcb2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "A3KGF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A3KGF7" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "A3KGF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A3KGF7" } ] } ] }, { "uniprot_ac": "D4A978", "gene_name": "Plcd3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "D4A978", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A978" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "D4A978", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A978" } ] } ] }, { "uniprot_ac": "F1M324", "gene_name": "Plcl2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "F1M324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M324" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "F1M324", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M324" } ] } ] }, { "uniprot_ac": "O75038", "gene_name": "PLCH2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "O75038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75038" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "O75038", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75038" } ] } ] }, { "uniprot_ac": "O89040", "gene_name": "Plcb2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "O89040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89040" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "O89040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89040" } ] } ] }, { "uniprot_ac": "P10686", "gene_name": "Plcg1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P10686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10686" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P10686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10686" } ] } ] }, { "uniprot_ac": "P10687", "gene_name": "Plcb1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P10687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10687" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P10687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10687" } ] } ] }, { "uniprot_ac": "P10688", "gene_name": "Plcd1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P10688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10688" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P10688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10688" } ] } ] }, { "uniprot_ac": "P13217", "gene_name": "norpA", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P13217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13217" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P13217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13217" } ] } ] }, { "uniprot_ac": "P16885", "gene_name": "PLCG2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P16885", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16885" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P16885", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16885" } ] } ] }, { "uniprot_ac": "P19174", "gene_name": "PLCG1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P19174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19174" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P19174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19174" } ] } ] }, { "uniprot_ac": "P24135", "gene_name": "Plcg2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P24135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24135" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P24135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24135" } ] } ] }, { "uniprot_ac": "P25455", "gene_name": "Plc21C", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P25455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25455" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P25455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25455" } ] } ] }, { "uniprot_ac": "P32383", "gene_name": "PLC1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P32383", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32383" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P32383", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32383" } ] } ] }, { "uniprot_ac": "P51178", "gene_name": "PLCD1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P51178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51178" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P51178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51178" } ] } ] }, { "uniprot_ac": "P51432", "gene_name": "Plcb3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "P51432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51432" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "P51432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51432" } ] } ] }, { "uniprot_ac": "Q00722", "gene_name": "PLCB2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q00722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00722" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q00722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q00722" } ] } ] }, { "uniprot_ac": "Q01970", "gene_name": "PLCB3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q01970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01970" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q01970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01970" } ] } ] }, { "uniprot_ac": "Q02158", "gene_name": "plc", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q02158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02158" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q02158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02158" } ] } ] }, { "uniprot_ac": "Q02979", "gene_name": "GDE1", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q02979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02979" } ] }, { "ec_number": "3.1.4.2", "activity": "", "evidence": [ { "id": "Q02979", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02979" } ] } ] }, { "uniprot_ac": "Q15111", "gene_name": "PLCL1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q15111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15111" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q15111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15111" } ] } ] }, { "uniprot_ac": "Q15147", "gene_name": "PLCB4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q15147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15147" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q15147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15147" } ] } ] }, { "uniprot_ac": "Q4KWH5", "gene_name": "Plch1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q4KWH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KWH5" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q4KWH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KWH5" } ] } ] }, { "uniprot_ac": "Q4KWH8", "gene_name": "PLCH1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q4KWH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KWH8" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q4KWH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KWH8" } ] } ] }, { "uniprot_ac": "Q5FX52", "gene_name": "Plcz1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q5FX52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FX52" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q5FX52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FX52" } ] } ] }, { "uniprot_ac": "Q62077", "gene_name": "Plcg1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q62077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62077" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q62077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62077" } ] } ] }, { "uniprot_ac": "Q62688", "gene_name": "Plcl1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q62688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62688" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q62688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62688" } ] } ] }, { "uniprot_ac": "Q62711", "gene_name": "Plcd4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q62711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62711" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q62711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62711" } ] } ] }, { "uniprot_ac": "Q640M6", "gene_name": "Gdpd5", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6" } ] }, { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q640M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q640M6" } ] } ] }, { "uniprot_ac": "Q80VJ4", "gene_name": "Gpcpd1", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q80VJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VJ4" } ] }, { "ec_number": "3.1.4.2", "activity": "", "evidence": [ { "id": "Q80VJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VJ4" } ] } ] }, { "uniprot_ac": "Q86YW0", "gene_name": "PLCZ1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q86YW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YW0" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q86YW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86YW0" } ] } ] }, { "uniprot_ac": "Q8C0L9", "gene_name": "Gpcpd1", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q8C0L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0L9" } ] }, { "ec_number": "3.1.4.2", "activity": "", "evidence": [ { "id": "Q8C0L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0L9" } ] } ] }, { "uniprot_ac": "Q8CIH5", "gene_name": "Plcg2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8CIH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIH5" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8CIH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIH5" } ] } ] }, { "uniprot_ac": "Q8K2J0", "gene_name": "Plcd3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8K2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2J0" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8K2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2J0" } ] } ] }, { "uniprot_ac": "Q8K3R3", "gene_name": "Plcd4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8K3R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3R3" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8K3R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3R3" } ] } ] }, { "uniprot_ac": "Q8K4D7", "gene_name": "Plcz1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8K4D7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4D7" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8K4D7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4D7" } ] } ] }, { "uniprot_ac": "Q8K4S1", "gene_name": "Plce1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8K4S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S1" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8K4S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S1" } ] } ] }, { "uniprot_ac": "Q8N3E9", "gene_name": "PLCD3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8N3E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N3E9" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8N3E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N3E9" } ] } ] }, { "uniprot_ac": "Q8R3B1", "gene_name": "Plcd1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8R3B1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3B1" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q8R3B1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3B1" } ] } ] }, { "uniprot_ac": "Q8WTR4", "gene_name": "GDPD5", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q8WTR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR4" } ] }, { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q8WTR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR4" } ] } ] }, { "uniprot_ac": "Q91UZ1", "gene_name": "Plcb4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q91UZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91UZ1" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q91UZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91UZ1" } ] } ] }, { "uniprot_ac": "Q99JE6", "gene_name": "Plcb3", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q99JE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JE6" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q99JE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JE6" } ] } ] }, { "uniprot_ac": "Q99P84", "gene_name": "Plce1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q99P84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P84" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q99P84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P84" } ] } ] }, { "uniprot_ac": "Q9BRC7", "gene_name": "PLCD4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9BRC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRC7" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9BRC7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BRC7" } ] } ] }, { "uniprot_ac": "Q9NPB8", "gene_name": "GPCPD1", "activity": [ { "ec_number": "3.1.4.2", "activity": "H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate.", "evidence": [ { "id": "Q9NPB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPB8" } ] }, { "ec_number": "3.1.4.2", "activity": "", "evidence": [ { "id": "Q9NPB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPB8" } ] } ] }, { "uniprot_ac": "Q9NQ66", "gene_name": "PLCB1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9NQ66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ66" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9NQ66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ66" } ] } ] }, { "uniprot_ac": "Q9P212", "gene_name": "PLCE1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9P212", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P212" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9P212", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P212" } ] } ] }, { "uniprot_ac": "Q9QW07", "gene_name": "Plcb4", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9QW07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QW07" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9QW07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QW07" } ] } ] }, { "uniprot_ac": "Q9UPR0", "gene_name": "PLCL2", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9UPR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPR0" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9UPR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UPR0" } ] } ] }, { "uniprot_ac": "Q9VXH3", "gene_name": "sl", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9VXH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXH3" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9VXH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VXH3" } ] } ] }, { "uniprot_ac": "Q9Z1B3", "gene_name": "Plcb1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q9Z1B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B3" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q9Z1B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }