{ "uniprot_canonical_ac": "Q63610-1", "uniprot_ac": "Q63610", "uniprot_id": "TPM3_RAT", "mass": { "chemical_mass": 29007.0, "monoisotopic_mass": 29007.0 }, "refseq": { "ac": "NP_001288215", "name": "tropomyosin alpha-3 chain isoform Tpm3.3cy", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" }, "gene_names": [ { "name": "Tpm3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q63610", "id": "Q63610" }, { "name": "TM30nm; Tpm5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006232646", "id": "XP_006232646" }, { "name": "Tpm-5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q63610", "id": "Q63610" }, { "name": "Tpm3_v1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q63610", "id": "Q63610" }, { "name": "Tpm3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006232646", "id": "XP_006232646" }, { "name": "Tpm5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q63610", "id": "Q63610" } ], "protein_names": [ { "name": "Tropomyosin alpha-3 chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q63610" }, { "name": "Gamma-tropomyosin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63610" }, { "name": "Tropomyosin-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63610" }, { "name": "Tropomyosin-5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63610" }, { "name": "tropomyosin alpha-3 chain isoform Tpm3.3cy", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215", "id": "NP_001288215" }, { "name": "tropomyosin alpha-3 chain isoform X13", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006232646", "id": "XP_006232646" }, { "name": "tropomyosin alpha-3 chain isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006232630", "id": "XP_006232630" }, { "name": "tropomyosin alpha-3 chain isoform X6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006232635", "id": "XP_006232635" }, { "name": "tropomyosin alpha-3 chain; tropomyosin non-muscle; nonmuscle tropomyosin 5; tropomyosin-5; gamma-tropomyosin; tropomyosin 3, gamma", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215", "id": "NP_001288215" } ], "function": [ { "annotation": "All studied gamma-tropomyosin mutants reduced Ca-induced activation but had no effect on the inhibition of actomyosin cross-bridges.", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" }, { "database": "PubMed", "id": "22749829", "url": "https://glygen.org/publication/PubMed/22749829" } ] }, { "annotation": "Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610#function" }, { "database": "UniProtKB", "id": "P09493", "url": "https://www.uniprot.org/uniprot/P09493#function" } ] }, { "annotation": "Physical interaction of tropomyosin 3 and STIM1 regulates vascular smooth muscle contractility and contributes to hypertension.", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" }, { "database": "PubMed", "id": "33341060", "url": "https://glygen.org/publication/PubMed/33341060" } ] }, { "annotation": "[Effects of tropomyosin 3 on pyroptosis of cardiomyocytes and fibroblast activation induced by hypoxia/reoxygenation in rats].", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" }, { "database": "PubMed", "id": "36880246", "url": "https://glygen.org/publication/PubMed/36880246" } ] } ], "disease": [ { "disease_id": "DOID:0080102", "recommended_name": { "id": "DOID:0080102", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080102", "name": "congenital myopathy 4A", "description": "A congenital myopathy that is characterized by skeletal muscle weakness, particularly in the muscles of the shoulders, upper arms, hips, and thighs." }, "synonyms": [ { "id": "DOID:0080102", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080102", "name": "congenital fiber-type disproportion", "description": "" }, { "id": "DOID:0080102", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080102", "name": "CFTD", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "congenital myopathy 4A, autosomal dominant", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "CAPM1", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "CFTD", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "CFTDM", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "NEM1", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "cap myopathy 1", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "fiber-type disproportion myopathy, congenital", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "myopathy, congenital, with fiber-type disproportion", "description": "" }, { "id": "MONDO:0800341", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800341", "name": "nemaline myopathy 1", "description": "" }, { "id": "MIM:255310", "resource": "MIM", "url": "https://www.omim.org/entry/255310", "name": "Congenital myopathy 4A, autosomal dominant", "description": "Congenital myopathy 4A, autosomal dominant" } ], "evidence": [ { "id": "0080102", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080102" } ] }, { "disease_id": "DOID:0110926", "recommended_name": { "id": "DOID:0110926", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110926", "name": "nemaline myopathy 1", "description": "A nemaline myopathy characterized by onset typically in early childhood of mildly delayed motor development, hypotonia, generalized muscle weakness, and weakness of the proximal limb muscles and neck muscles, resulting in difficulty running and easy fatigability that has_material_basis_in heterozygous, homozygous, or compound heterozygous mutation in the TPM3 gene on chromosome 1q21." }, "synonyms": [ { "id": "DOID:0110926", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110926", "name": "NEM1", "description": "" }, { "id": "DOID:0110926", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110926", "name": "nemaline myopathy 1, autosomal dominant or recessive", "description": "" }, { "id": "DOID:0110926", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110926", "name": "congenital myopathy 4B", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "congenital myopathy 4B, autosomal recessive", "description": "Any congenital myopathy in which the cause of the disease is a mutation in the TPM3 gene." }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "TPM3 nemaline myopathy", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "nemaline myopathy caused by mutation in TPM3", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "NEM1", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "Nem1", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "nemaline myopathy 1", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "nemaline myopathy 1, autosomal dominant or recessive", "description": "" }, { "id": "MONDO:0012239", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012239", "name": "nemaline myopathy type 1", "description": "" }, { "id": "MIM:609284", "resource": "MIM", "url": "https://www.omim.org/entry/609284", "name": "Congenital myopathy 4B, autosomal recessive", "description": "Congenital myopathy 4B, autosomal recessive" } ], "evidence": [ { "id": "0110926", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110926" } ] }, { "disease_id": "DOID:12930", "recommended_name": { "id": "DOID:12930", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12930", "name": "dilated cardiomyopathy", "description": "An intrinsic cardiomyopathy that is characterized by an an enlarged heart and damage to the myocardium causing the heart to pump blood inefficiently." }, "synonyms": [ { "id": "DOID:12930", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12930", "name": "primary dilated cardiomyopathy", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy 1A", "description": "Familial dilated cardiomyopathy with conduction defect due to LMNA mutation is a rare familial dilated cardiomyopathy characterized by left ventricular enlargement and/or reduced systolic function preceded or accompanied by significant conduction system disease and/or arrhythmias including bradyarrhythmias, supraventricular or ventricular arrhythmias. Disease onset is usually in early to mid-adulthood. Sudden cardiac death may occur and may be the presenting symptom. In some cases, it is associated with skeletal myopathy and elevated serum creatine kinase." }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "CDCD1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "LMNA familial isolated dilated cardiomyopathy", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy dilated with conduction defect type 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, type 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy type 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "dilated cardiomyopathy with conduction defect 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "familial dilated cardiomyopathy with conduction defect due to LMNA mutation", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "familial isolated dilated cardiomyopathy caused by mutation in LMNA", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, congestive", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, 1A", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, dilated, with conduction defect 1", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, familial idiopathic", "description": "" }, { "id": "MONDO:0007269", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007269", "name": "cardiomyopathy, idiopathic dilated", "description": "" }, { "id": "MIM:115200", "resource": "MIM", "url": "https://www.omim.org/entry/115200", "name": "Cardiomyopathy, dilated, 1A", "description": "Cardiomyopathy, dilated, 1A" } ], "evidence": [ { "id": "12930", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12930" } ] }, { "disease_id": "DOID:3969", "recommended_name": { "id": "DOID:3969", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3969", "name": "thyroid gland papillary carcinoma", "description": "A differentiated thyroid gland carcinoma that is characterized by the small mushroom shape of the tumor which has a stem attached to the epithelial layer and arises from the follicular cells of the thyroid gland." }, "synonyms": [ { "id": "DOID:3969", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3969", "name": "Papillary carcinoma of the Thyroid gland", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "thyroid cancer, nonmedullary, 1", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "thyroid cancer, nonmedullary, 1", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "thyroid cancer, nonmedullary, type 1", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "NMTC1", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "familial nonmedullary thyroid cancer, papillary", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "nonmedullary thyroid carcinoma, papillary", "description": "" }, { "id": "MONDO:0008567", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008567", "name": "papillary carcinoma of thyroid", "description": "" }, { "id": "MIM:188550", "resource": "MIM", "url": "https://www.omim.org/entry/188550", "name": "Thyroid cancer, non-medullary, 1", "description": "Thyroid cancer, non-medullary, 1" } ], "evidence": [ { "id": "3969", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3969" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "common_name": "Rat" } ], "gene": [ { "name": "Tpm3", "url": "https://www.uniprot.org/uniprot/Q63610", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000017441", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000017441", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "117557", "url": "https://www.ncbi.nlm.nih.gov/gene/117557", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q63610", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q63610*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000533", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000533", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014751", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014751", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:117557", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:117557", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LELEWEM", "url": "https://omabrowser.org/oma/group/LELEWEM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5398117at2759", "url": "http://www.orthodb.org/?query=5398117at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19269", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19269", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19269:SF38", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19269:SF38", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19269:SF73", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19269:SF73", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00261", "url": "http://pfam.xfam.org/family/PF00261", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q63610", "url": "http://purl.obolibrary.org/obo/PR_Q63610", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621546", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621546", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "708368", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=708368", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A140TAF0", "url": "https://www.uniprot.org/uniprot/A0A140TAF0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TAF0-1", "url": "https://www.uniprot.org/uniprot/A0A140TAF0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A144", "url": "https://www.uniprot.org/uniprot/A0A8I6A144", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A144-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A144-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6B5K9", "url": "https://www.uniprot.org/uniprot/A0A8I6B5K9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6B5K9-1", "url": "https://www.uniprot.org/uniprot/A0A8I6B5K9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6G322", "url": "https://www.uniprot.org/uniprot/A0A8I6G322", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6G322-1", "url": "https://www.uniprot.org/uniprot/A0A8I6G322-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QDD2", "url": "https://www.uniprot.org/uniprot/A0A8L2QDD2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QDD2-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QDD2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QDD9", "url": "https://www.uniprot.org/uniprot/A0A8L2QDD9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QDD9-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QDD9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63610-1", "url": "https://www.uniprot.org/uniprot/Q63610-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63610-2", "url": "https://www.uniprot.org/uniprot/Q63610-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63610-3", "url": "https://www.uniprot.org/uniprot/Q63610-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM", "length": 248, "header": "sp|Q63610-1|TPM3_RAT Isoform 1 of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=2 CANONICAL=Q63610-1" }, "isoforms": [ { "isoform_ac": "A0A140TAF0-1", "url": "", "sequence": { "sequence": "MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI", "length": 285, "header": "tr|A0A140TAF0-1|TPM3_RAT Computationally mapped isoform of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175543670, "end_pos": 175517309, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101614.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101614.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094091.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094091.1" } ] } }, { "isoform_ac": "A0A8I6A144-1", "url": "", "sequence": { "sequence": "MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM", "length": 285, "header": "tr|A0A8I6A144-1|A0A8I6A144_RAT Computationally mapped isoform of Tropomyosin 3 OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=3 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175543749, "end_pos": 175517309, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000114156.1", "url": "https://www.ensembl.org/id/ENSRNOT00000114156.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085183.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085183.1" } ] } }, { "isoform_ac": "A0A8I6B5K9-1", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKKHEGKVTTFILLVFPQAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM", "length": 243, "header": "tr|A0A8I6B5K9-1|TPM3_RAT Computationally mapped isoform of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175543749, "end_pos": 175523770, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101991.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101991.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097306.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097306.1" } ] } }, { "isoform_ac": "A0A8I6G322-1", "url": "", "sequence": { "sequence": "METPVAVGWKNSLYPLNCGEAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM", "length": 224, "header": "tr|A0A8I6G322-1|TPM3_RAT Computationally mapped isoform of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175543749, "end_pos": 175527602, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000112248.1", "url": "https://www.ensembl.org/id/ENSRNOT00000112248.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079275.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079275.1" } ] } }, { "isoform_ac": "A0A8L2QDD2-1", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI", "length": 248, "header": "tr|A0A8L2QDD2-1|A0A8L2QDD2_RAT Computationally mapped isoform of Tropomyosin 3 OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175543670, "end_pos": 175523770, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000023567.9", "url": "https://www.ensembl.org/id/ENSRNOT00000023567.9" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000023567.6", "url": "https://www.ensembl.org/id/ENSRNOP00000023567.6" } ] } }, { "isoform_ac": "A0A8L2QDD9-1", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEERLYSQLERNRLLSNELKLTLHGLCD", "length": 247, "header": "tr|A0A8L2QDD9-1|A0A8L2QDD9_RAT Computationally mapped isoform of Tropomyosin 3 OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=1 CANONICAL=Q63610-1" }, "locus": { "chromosome": "2", "start_pos": 175542591, "end_pos": 175523770, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000023605.8", "url": "https://www.ensembl.org/id/ENSRNOT00000023605.8" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000023605.4", "url": "https://www.ensembl.org/id/ENSRNOP00000023605.4" } ] } }, { "isoform_ac": "Q63610-1", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM", "length": 248, "header": "sp|Q63610-1|TPM3_RAT Isoform 1 of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=2 CANONICAL=Q63610-1" }, "locus": {} }, { "isoform_ac": "Q63610-2", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI", "length": 248, "header": "sp|Q63610-2|TPM3_RAT Isoform 2 of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=2 CANONICAL=Q63610-1" }, "locus": {} }, { "isoform_ac": "Q63610-3", "url": "", "sequence": { "sequence": "MAGSTTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEERLYSQLERNRLLSNELKLTLHGLCD", "length": 247, "header": "sp|Q63610-3|TPM3_RAT Isoform 3 of Tropomyosin alpha-3 chain OS=Rattus norvegicus OX=10116 GN=Tpm3 PE=1 SV=2 CANONICAL=Q63610-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "site_lbl": "Ser179" }, { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "site_lbl": "Thr216" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "site_lbl": "Ser51" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "site_lbl": "Thr72" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Functional effects of congenital myopathy-related mutations in gamma-tropomyosin gene.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Robaszkiewicz K, Dudek E, Kasprzak AA, Moraczewska J", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" } ], "reference": [ { "type": "PubMed", "id": "22749829", "url": "https://glygen.org/publication/PubMed/22749829" } ] }, { "title": "Physical interaction of tropomyosin 3 and STIM1 regulates vascular smooth muscle contractility and contributes to hypertension.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2021", "authors": "Xu F, Zhu J, Chen Y, He K, Guo J, Bai S, Zhao R, Du J, Shen B", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" } ], "reference": [ { "type": "PubMed", "id": "33341060", "url": "https://glygen.org/publication/PubMed/33341060" } ] }, { "title": "[Effects of tropomyosin 3 on pyroptosis of cardiomyocytes and fibroblast activation induced by hypoxia/reoxygenation in rats].", "journal": "Zhonghua wei zhong bing ji jiu yi xue", "date": "2023", "authors": "Tian H, Hu H", "evidence": [ { "database": "RefSeq", "id": "NP_001288215", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288215" } ], "reference": [ { "type": "PubMed", "id": "36880246", "url": "https://glygen.org/publication/PubMed/36880246" } ] }, { "title": "Identification of novel alternatively spliced isoforms of the tropomyosin-encoding gene, TMnm, in the rat cochlea.", "journal": "Gene", "date": "1994", "authors": "Beisel KW, Kennedy JE", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "reference": [ { "type": "PubMed", "id": "8206382", "url": "https://glygen.org/publication/PubMed/8206382" } ] }, { "title": "Transformation-related expression of a low-molecular-mass tropomyosin isoform TM5/TM30nm in transformed rat fibroblastic cell lines.", "journal": "J. Cancer Res. Clin. Oncol.", "date": "1997", "authors": "Sato M., Taniguchi S., Miyado K.", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "reference": [ { "type": "PubMed", "id": "9222299", "url": "https://glygen.org/publication/PubMed/9222299" } ] } ], "pathway": [ { "id": "rno:117557", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:117557", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "actin filament", "id": "GO:0005884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005884", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "brush border", "id": "GO:0005903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005903", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "podosome", "id": "GO:0002102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002102", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "stress fiber", "id": "GO:0001725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001725", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "cortical cytoskeleton", "id": "GO:0030863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030863", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "muscle contraction", "id": "GO:0006936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006936", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "Q63610", "url": "https://www.uniprot.org/uniprot/Q63610" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }