{ "uniprot_canonical_ac": "Q63247-1", "uniprot_ac": "Q63247", "uniprot_id": "FOXJ1_RAT", "mass": { "chemical_mass": 45566.0, "monoisotopic_mass": 45566.0 }, "refseq": { "ac": "NP_446284", "name": "forkhead box protein J1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284" }, "gene_names": [ { "name": "Foxj1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q63247", "id": "Q63247" }, { "name": "Foxj1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284", "id": "NP_446284" }, { "name": "Hfh-4; Hfh4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284", "id": "NP_446284" }, { "name": "Hfh4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q63247", "id": "Q63247" } ], "protein_names": [ { "name": "Forkhead box protein J1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q63247" }, { "name": "HFH-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63247" }, { "name": "Hepatocyte nuclear factor 3 forkhead homolog 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63247" }, { "name": "forkhead box protein J1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284", "id": "NP_446284" }, { "name": "hepatocyte nuclear factor 3 forkhead homolog 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284", "id": "NP_446284" } ], "function": [ { "annotation": "Expression and localization of FOXJ1 in S100beta-positive multiciliated cells of the rat pituitary has been described.", "evidence": [ { "database": "RefSeq", "id": "NP_446284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284" }, { "database": "PubMed", "id": "27660208", "url": "https://glygen.org/publication/PubMed/27660208" } ] }, { "annotation": "Transcription factor specifically required for the formation of motile cilia. Acts by activating transcription of genes that mediate assembly of motile cilia, such as CFAP157. Binds the DNA consensus sequences 5'-HWDTGTTTGTTTA-3' or 5'-KTTTGTTGTTKTW-3' (where H is not G, W is A or T, D is not C, and K is G or T). Activates the transcription of a variety of ciliary proteins in the developing brain and lung.", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247#function" }, { "database": "UniProtKB", "id": "Q61660", "url": "https://www.uniprot.org/uniprot/Q61660#function" } ] } ], "disease": [ { "disease_id": "DOID:0050144", "recommended_name": { "id": "DOID:0050144", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050144", "name": "Kartagener syndrome", "description": "A primary ciliary dyskinesia that is characterized by sinusitis, bronchiectasis and situs inversus with dextrocardia resulting from dysfunction of the cilia during embryologic development." }, "synonyms": [ { "id": "DOID:0050144", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050144", "name": "Kartagener's syndrome", "description": "" } ], "evidence": [ { "id": "0050144", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050144" } ] }, { "disease_id": "DOID:0111856", "recommended_name": { "id": "DOID:0111856", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111856", "name": "primary ciliary dyskinesia 43", "description": "A primary ciliary dyskinesia characterized by reduced generation of multiple motile cilia, onset of respiratory insufficiency soon after birth, recurrent upper and lower respiratory infections,variable infertility, and laterality defects in about half of patients that has_material_basis_in heterozygous mutation in FOXJ1 on chromosome 17q25.1." }, "synonyms": [ { "id": "DOID:0111856", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111856", "name": "CILD43", "description": "" }, { "id": "DOID:0111856", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111856", "name": "primary ciliary dyskinesia 43 with or without situs inversus", "description": "" }, { "id": "MONDO:0032874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032874", "name": "ciliary dyskinesia, primary, 43", "description": "" }, { "id": "MONDO:0032874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032874", "name": "CILD43", "description": "" }, { "id": "MONDO:0032874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032874", "name": "CILIARY DYSKINESIA, PRIMARY, 43", "description": "" }, { "id": "MONDO:0032874", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032874", "name": "Ciliary Dyskinesia, Primary, 43, With or Without Situs Inversus", "description": "" }, { "id": "MIM:618699", "resource": "MIM", "url": "https://www.omim.org/entry/618699", "name": "Ciliary dyskinesia, primary, 43", "description": "Ciliary dyskinesia, primary, 43" } ], "evidence": [ { "id": "0111856", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111856" } ] }, { "disease_id": "DOID:9562", "recommended_name": { "id": "DOID:9562", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9562", "name": "primary ciliary dyskinesia", "description": "A ciliopathy that is characterized by impaired function of the cilia lining the respiratory tract (lower and upper, sinuses, Eustachian tube, middle ear) and fallopian tube." }, "synonyms": [ { "id": "DOID:9562", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9562", "name": "ciliary motility disorder", "description": "" }, { "id": "DOID:9562", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9562", "name": "immotile ciliary syndrome", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "primary ciliary dyskinesia 1", "description": "Any primary ciliary dyskinesia in which the cause of the disease is a mutation in the DNAI1 gene." }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "CILD1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "DNAI1 primary ciliary dyskinesia", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "ciliary dyskinesia, primary, type 1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "primary ciliary dyskinesia 1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "primary ciliary dyskinesia 1 with or without situs inversus", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "primary ciliary dyskinesia caused by mutation in DNAI1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "primary ciliary dyskinesia type 1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "Kartagener syndrome", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "PCD", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "Polynesian bronchiectasis", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "Siewert syndrome", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "ciliary dyskinesia, primary, 1", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "ciliary dyskinesia, primary, 1, with or without situs inversus", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "dextrocardia, bronchiectasis, and sinusitis", "description": "" }, { "id": "MONDO:0009484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009484", "name": "immotile cilia syndrome", "description": "" }, { "id": "MIM:244400", "resource": "MIM", "url": "https://www.omim.org/entry/244400", "name": "Kartagener syndrome", "description": "Kartagener syndrome" } ], "evidence": [ { "id": "9562", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9562" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "common_name": "Rat" } ], "gene": [ { "name": "Foxj1", "url": "https://www.uniprot.org/uniprot/Q63247", "locus": { "chromosome": "10", "start_pos": 101566304, "end_pos": 101570237, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000046001", "url": "https://www.ensembl.org/id/ENSRNOG00000046001" } ] } } ], "crossref": [ { "id": "cd20023", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20023", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "116557", "url": "https://www.ncbi.nlm.nih.gov/gene/116557", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030456", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047512", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047512", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047513", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047513", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:116557", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:116557", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ATWGPPV", "url": "https://omabrowser.org/oma/group/ATWGPPV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5385885at2759", "url": "http://www.orthodb.org/?query=5385885at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46805", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46805", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46805:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46805:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00250", "url": "http://pfam.xfam.org/family/PF00250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q63247", "url": "http://purl.obolibrary.org/obo/PR_Q63247", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_446284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621764", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621764", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6GK97", "url": "https://www.uniprot.org/uniprot/A0A8I6GK97", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GK97-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GK97-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63247-1", "url": "https://www.uniprot.org/uniprot/Q63247-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPLGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSTAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPATWGPPVEQATDSLDFDETFLATSFLQHPWDESSSGCLPPEPLFEAGDATLAADLQDWASVGAFL", "length": 421, "header": "sp|Q63247-1|FOXJ1_RAT Isoform 1 of Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1 CANONICAL=Q63247-1" }, "isoforms": [ { "isoform_ac": "A0A8I6GK97-1", "url": "", "sequence": { "sequence": "MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSTAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPATWGPPVEQATDSLDFDETFLATSFLQHPWDESSSGCLPPEPLFEAGDATLAADLQDWASVGAFL", "length": 421, "header": "tr|A0A8I6GK97-1|A0A8I6GK97_RAT Computationally mapped isoform of Forkhead box J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=3 SV=1 CANONICAL=Q63247-1" }, "locus": { "chromosome": "10", "start_pos": 101570201, "end_pos": 101567294, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000072687.3", "url": "https://www.ensembl.org/id/ENSRNOT00000072687.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000092642.1", "url": "https://www.ensembl.org/id/ENSRNOP00000092642.1" } ] } }, { "isoform_ac": "Q63247-1", "url": "", "sequence": { "sequence": "MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPLGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSTAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPATWGPPVEQATDSLDFDETFLATSFLQHPWDESSSGCLPPEPLFEAGDATLAADLQDWASVGAFL", "length": 421, "header": "sp|Q63247-1|FOXJ1_RAT Isoform 1 of Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1 CANONICAL=Q63247-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Expression and localization of forkhead box protein FOXJ1 in S100beta-positive multiciliated cells of the rat pituitary.", "journal": "Medical molecular morphology", "date": "2017", "authors": "Nakakura T, Suzuki T, Horiguchi K, Fujiwara K, Tsukada T, Asano-Hoshino A, Tanaka H, Arisawa K, Nishijima Y, Nekooki-Machida Y, Kiuchi Y, Hagiwara H", "evidence": [ { "database": "RefSeq", "id": "NP_446284", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446284" } ], "reference": [ { "type": "PubMed", "id": "27660208", "url": "https://glygen.org/publication/PubMed/27660208" } ] }, { "title": "Primary structure of hepatocyte nuclear factor/forkhead homologue 4 and characterization of gene expression in the developing respiratory and reproductive epithelium.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Liang M., Gitlin J.D., Brody S.L., Hackett B.P., Bruns L.A., Zeitz I.D.", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "reference": [ { "type": "PubMed", "id": "7753791", "url": "https://glygen.org/publication/PubMed/7753791" } ] } ], "pathway": [ { "id": "rno:116557", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:116557", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q61660-1", "protein_name": "Forkhead box protein J1", "gene_name": "Foxj1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAESWLRLCGAGPGEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQEEQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGDVDLTVHGRHINCPATWGPPAEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPIFEAGDATLAADLQDWASVGAFL", "length": 421 }, "evidence": [ { "id": "45229819", "url": "http://www.informatics.jax.org/homology/45229819", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q92949-1", "protein_name": "Forkhead box protein J1", "gene_name": "FOXJ1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL", "length": 421 }, "evidence": [ { "id": "45229819", "url": "http://www.informatics.jax.org/homology/45229819", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 38, "go_terms": [ { "name": "left/right pattern formation", "id": "GO:0060972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060972", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "epithelium development", "id": "GO:0060429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060429", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "central tolerance induction", "id": "GO:0002508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002508", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of germinal center formation", "id": "GO:0002635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002635", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "positive regulation of central B cell tolerance induction", "id": "GO:0002897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002897", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "establishment of apical/basal cell polarity", "id": "GO:0035089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035089", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "glomerular parietal epithelial cell development", "id": "GO:0072016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072016", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "positive regulation of lung ciliated cell differentiation", "id": "GO:1901248", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901248", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of interleukin-6 production", "id": "GO:0032715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032715", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of T cell proliferation", "id": "GO:0042130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042130", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of NF-kappaB transcription factor activity", "id": "GO:0032088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032088", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "response to estradiol", "id": "GO:0032355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032355", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "leukocyte migration", "id": "GO:0050900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050900", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "determination of left/right symmetry", "id": "GO:0007368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007368", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "activation of GTPase activity", "id": "GO:0090630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090630", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "motile cilium assembly", "id": "GO:0044458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044458", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "cell maturation", "id": "GO:0048469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048469", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "regulation of epithelial cell differentiation", "id": "GO:0030856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030856", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "axoneme assembly", "id": "GO:0035082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035082", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "metanephric part of ureteric bud development", "id": "GO:0035502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035502", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "lung epithelium development", "id": "GO:0060428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060428", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of B cell activation", "id": "GO:0050869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050869", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of T cell differentiation in thymus", "id": "GO:0033085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033085", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "cellular response to insulin-like growth factor stimulus", "id": "GO:1990314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990314", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "ciliary basal body organization", "id": "GO:0032053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032053", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "negative regulation of humoral immune response mediated by circulating immunoglobulin", "id": "GO:0002924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002924", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q63247", "url": "https://www.uniprot.org/uniprot/Q63247" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }