{ "uniprot_canonical_ac": "Q63189-1", "uniprot_ac": "Q63189", "uniprot_id": "PRG2_RAT", "mass": { "chemical_mass": 25129.0, "monoisotopic_mass": 25129.0 }, "refseq": { "ac": "NP_113807", "name": "bone marrow proteoglycan precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113807" }, "gene_names": [ { "name": "Prg2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q63189", "id": "Q63189" }, { "name": "Mbp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q63189", "id": "Q63189" }, { "name": "Prg2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113807", "id": "NP_113807" } ], "protein_names": [ { "name": "Bone marrow proteoglycan", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q63189" }, { "name": "BMPG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63189" }, { "name": "Proteoglycan 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q63189" }, { "name": "bone marrow proteoglycan precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113807", "id": "NP_113807" }, { "name": "bone marrow proteoglycan; BMPG; eosinophil major basic protein; proteoglycan 2, bone marrow", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113807", "id": "NP_113807" } ], "function": [ { "annotation": "Cytotoxin and helminthotoxin. MBP also induces non-cytolytic histamine release from basophils. It is involved in antiparasitic defense mechanisms and immune hypersensitivity reactions (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189#function" } ] } ], "disease": [ { "disease_id": "DOID:12140", "recommended_name": { "id": "DOID:12140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12140", "name": "Chagas disease", "description": "A trypanosomiasis that is a tropical parasitic disease caused by the flagellate protozoan Trypanosoma cruzi, which is transmitted to humans and other mammals by an insect vector, the blood-sucking assassin bugs of the subfamily Triatominae (family Reduviidae), most commonly species belonging to the Triatoma, Rhodnius, and Panstrongylus genera. The symptoms include fever, fatigue, body aches, headache, rash, loss of appetite, diarrhea, vomiting, swelling of the eyelids and myocarditis." }, "synonyms": [ { "id": "DOID:12140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12140", "name": "Chagas' disease", "description": "" }, { "id": "DOID:12140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12140", "name": "chagas' disease with digestive system involvement", "description": "" }, { "id": "DOID:12140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12140", "name": "chagas' disease with nervous system involvement", "description": "" }, { "id": "DOID:12140", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12140", "name": "chagas' disease with other organ involvement", "description": "" } ], "evidence": [ { "id": "12140", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12140" } ] }, { "disease_id": "DOID:1725", "recommended_name": { "id": "DOID:1725", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1725", "name": "peritoneum cancer", "description": "An organ system cancer that is located in the peritoneum." }, "synonyms": [], "evidence": [ { "id": "1725", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1725" } ] }, { "disease_id": "DOID:2841", "recommended_name": { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "asthma", "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing." }, "synonyms": [ { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "Exercise induced asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "bronchial hyperreactivity", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with acute exacerbation", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "chronic obstructive asthma with status asthmaticus", "description": "" }, { "id": "DOID:2841", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2841", "name": "exercise-induced asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "inherited susceptibility to asthma", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, nocturnal, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, bronchial", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, diminished response to Antileukotriene treatment 1N", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, protection against", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma, susceptibility to", "description": "" }, { "id": "MONDO:0010940", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010940", "name": "asthma-related traits, susceptibility to", "description": "" }, { "id": "MIM:600807", "resource": "MIM", "url": "https://www.omim.org/entry/600807", "name": "Asthma", "description": "Asthma" } ], "evidence": [ { "id": "2841", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2841" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "common_name": "Rat" } ], "gene": [ { "name": "Prg2", "url": "https://www.uniprot.org/uniprot/Q63189", "locus": { "chromosome": "3", "start_pos": 70066101, "end_pos": 70062535, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000008394", "url": "https://www.ensembl.org/id/ENSRNOG00000008394" } ] } } ], "crossref": [ { "id": "ENSRNOG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008394", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03598", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03598", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "58826", "url": "https://www.ncbi.nlm.nih.gov/gene/58826", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q63189", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q63189*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001304", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033816", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033816", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:58826", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:58826", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WGRCKRF", "url": "https://omabrowser.org/oma/group/WGRCKRF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3773050at2759", "url": "http://www.orthodb.org/?query=3773050at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22803", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22803", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22803:SF124", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22803:SF124", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00059", "url": "http://pfam.xfam.org/family/PF00059", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q63189", "url": "http://purl.obolibrary.org/obo/PR_Q63189", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_113807", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_113807", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "69336", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=69336", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "G3V729", "url": "https://www.uniprot.org/uniprot/G3V729", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V729-1", "url": "https://www.uniprot.org/uniprot/G3V729-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q63189-1", "url": "https://www.uniprot.org/uniprot/Q63189-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKFPLLLALLVGGAFALHLSSEASDSKSPLVDESLPREAEISRPEVEESPPGEQLMSLEEEEEEEEEEGSGSEGALGNEGAVSGQDVTDENLQSPKEEDTTSLMGDSGFKTGRYLLVRRPECFNKAQLVCRSCYRGTLASIHSFSVNFRIQSFVRGINQGQVWIGGRIVGWGRCKRFRWIDGSSWNFAYWAAGQPRRGGGRCVTLCTRGGHWRRSGCGKRRPFICAY", "length": 227, "header": "sp|Q63189-1|PRG2_RAT Isoform 1 of Bone marrow proteoglycan OS=Rattus norvegicus OX=10116 GN=Prg2 PE=2 SV=1 CANONICAL=Q63189-1" }, "isoforms": [ { "isoform_ac": "G3V729-1", "url": "", "sequence": { "sequence": "MKFPLLLALLVGGAFALHLSSEASDSKSPLVDESLPREAEISRPEVEECPPGEQLMSLEEEEEEEEEEGSGSEGALGNEGAVSGQDVTDENLQCPKEEDTTSLMGDSGFKTGRYLLVRRPECFNKAQLVCRSCYRGTLASIHSFSVNFRIQSFVRGINQGQVWIGGRIVGWGRCKRFRWIDGSSWNFAYWAAGQPRRGGGRCVTLCTRGGHWRRSGCGKRRPFICAY", "length": 227, "header": "tr|G3V729-1|PRG2_RAT Computationally mapped isoform of Bone marrow proteoglycan OS=Rattus norvegicus OX=10116 GN=Prg2 PE=2 SV=1 CANONICAL=Q63189-1" }, "locus": { "chromosome": "3", "start_pos": 70065984, "end_pos": 70063374, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000011168.4", "url": "https://www.ensembl.org/id/ENSRNOT00000011168.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000011168.1", "url": "https://www.ensembl.org/id/ENSRNOP00000011168.1" } ] } }, { "isoform_ac": "Q63189-1", "url": "", "sequence": { "sequence": "MKFPLLLALLVGGAFALHLSSEASDSKSPLVDESLPREAEISRPEVEESPPGEQLMSLEEEEEEEEEEGSGSEGALGNEGAVSGQDVTDENLQSPKEEDTTSLMGDSGFKTGRYLLVRRPECFNKAQLVCRSCYRGTLASIHSFSVNFRIQSFVRGINQGQVWIGGRIVGWGRCKRFRWIDGSSWNFAYWAAGQPRRGGGRCVTLCTRGGHWRRSGCGKRRPFICAY", "length": 227, "header": "sp|Q63189-1|PRG2_RAT Isoform 1 of Bone marrow proteoglycan OS=Rattus norvegicus OX=10116 GN=Prg2 PE=2 SV=1 CANONICAL=Q63189-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 24, "start_aa": "Ser", "end_pos": 24, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser24", "evidence": [ { "id": "Q63189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63189#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 70, "start_aa": "Ser", "end_pos": 70, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser70", "evidence": [ { "id": "Q63189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63189#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Cloning of cDNA for rat eosinophil major basic protein.", "journal": "Biochim. Biophys. Acta", "date": "1995", "authors": "Nittoh T, Watanabe M, Okayama H, Misawa S, Isobe Y, Hayashi H, Mue S, Ohuchi K", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "reference": [ { "type": "PubMed", "id": "8547309", "url": "https://glygen.org/publication/PubMed/8547309" } ] } ], "pathway": [ { "id": "rno:58826", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:58826", "resource": "KEGG Pathway" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P13727-1", "protein_name": "Bone marrow proteoglycan", "gene_name": "PRG2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY", "length": 222 }, "evidence": [ { "id": "45243335", "url": "http://www.informatics.jax.org/homology/45243335", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q61878-1", "protein_name": "Bone marrow proteoglycan", "gene_name": "Prg2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKFPLLLALLVGGASALHLSSETSDSKSPLMDENLPRDAEISGPEGEECPPGEELMPLEGEKEEGSGSEGVPGDEGAVSGQDVTDVDLQCPKEEDTTSLMGDSGCKTCRYLLVRRAECFDKAQSVCRRCYRGTLASIHSFSVNFGIQSAVRGINQGQVWIGGRIKGWGRCKRFRWVDGSSWNFAYWAAGQPCPGGGRCVTLCTQGGHWRLSHCVKRRPFICSY", "length": 223 }, "evidence": [ { "id": "45243335", "url": "http://www.informatics.jax.org/homology/45243335", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "negative regulation of interleukin-10 production", "id": "GO:0032693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032693", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "negative regulation of macrophage cytokine production", "id": "GO:0010936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010936", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "defense response to nematode", "id": "GO:0002215", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002215", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "positive regulation of interleukin-4 production", "id": "GO:0032753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032753", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "Q63189", "url": "https://www.uniprot.org/uniprot/Q63189" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }