{ "uniprot_canonical_ac": "Q62878-1", "uniprot_ac": "Q62878", "uniprot_id": "3BHS4_RAT", "mass": { "chemical_mass": 41957.0, "monoisotopic_mass": 41957.0 }, "refseq": { "ac": "NP_058961", "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961" }, "gene_names": [ { "name": "Hsd3b6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q62878", "id": "Q62878" }, { "name": "Hsd3b1; Hsd3b2l1; Hsd3b6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961", "id": "NP_058961" }, { "name": "Hsd3b2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961", "id": "NP_058961" } ], "protein_names": [ { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q62878" }, { "name": "3 beta-hydroxysteroid dehydrogenase 6; 3-beta-HSD IV; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IV; hydroxysteroid dehydrogenase-6 delta<5>-3-beta; Hydroxy-delta-5-steroid dehydrogenase 3 beta- and steroid delta-isomerase; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961", "id": "NP_058961" }, { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961", "id": "NP_058961" }, { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IV", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q62878" }, { "name": "3-beta-HSD IV", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q62878" }, { "name": "3-beta-hydroxy-5-ene steroid dehydrogenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q62878" }, { "name": "Delta-5-3-ketosteroid isomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q62878" }, { "name": "Progesterone reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q62878" } ], "function": [ { "annotation": "3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878#function" } ] }, { "annotation": "Lycopene protects against PCB-induced changes in Leydig cellular StAR protein, cytochrome P450 scc expression and activity of 3beta-HSD.", "evidence": [ { "database": "RefSeq", "id": "NP_058961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961" }, { "database": "PubMed", "id": "19071209", "url": "https://glygen.org/publication/PubMed/19071209" } ] }, { "annotation": "The present studies showed differences in AR and 3beta-HSD distribution within various generations of corpora lutea (CL) and within particular regions of the same young CL.", "evidence": [ { "database": "RefSeq", "id": "NP_058961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961" }, { "database": "PubMed", "id": "17257522", "url": "https://glygen.org/publication/PubMed/17257522" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:10892", "recommended_name": { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "hypospadias", "description": "A physical disorder characterized by an abnormally placed urethral opening on the underside of the penis or on the perineum." }, "synonyms": [ { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "familial hypospadias", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal, multifactorial", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "HYSP3", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "HYSP4", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked, susceptibility to", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "HYSP2", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "HYSP1", "description": "" }, { "id": "MIM:300758", "resource": "MIM", "url": "https://www.omim.org/entry/300758", "name": "Hypospadias 2, X-linked", "description": "Hypospadias 2, X-linked" }, { "id": "MIM:300633", "resource": "MIM", "url": "https://www.omim.org/entry/300633", "name": "Hypospadias 1, X-linked", "description": "Hypospadias 1, X-linked" } ], "evidence": [ { "id": "10892", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10892" } ] }, { "disease_id": "DOID:11612", "recommended_name": { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary syndrome", "description": "An ovarian dysfunction that is characterized by hyperandrogenism, polycystic ovaries, hirsutism, oligomenorrhea or amenorrhea, anovulation and excessive body weight." }, "synonyms": [ { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Multicystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "PCOS", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic Ovarian disease", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "A disorder that manifests as multiple cysts on the ovaries. It results in hormonal imbalances and leads to irregular and abnormal menstrual periods, excess growth of hair, acne eruptions and obesity." }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "multicystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovarian disease", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome 1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCO1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "hyperandrogenemia", "description": "" } ], "evidence": [ { "id": "11612", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11612" } ] }, { "disease_id": "DOID:12700", "recommended_name": { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinemia", "description": "An acquired metabolic disease that has_material_basis_in the presence of abnormally-high levels of prolactin in the blood." }, "synonyms": [ { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Chiari-Frommel syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Pregnancy-related A-G syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinaemia", "description": "" } ], "evidence": [ { "id": "12700", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12700" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "common_name": "Rat" } ], "gene": [ { "name": "Hsd3b6", "url": "https://www.uniprot.org/uniprot/Q62878", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000019441", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019441", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "29632", "url": "https://www.ncbi.nlm.nih.gov/gene/29632", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:29632", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29632", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DTFYTCA", "url": "https://omabrowser.org/oma/group/DTFYTCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3675908at2759", "url": "http://www.orthodb.org/?query=3675908at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43245", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43245", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43245:SF51", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43245:SF51", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01073", "url": "http://pfam.xfam.org/family/PF01073", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q62878", "url": "http://purl.obolibrary.org/obo/PR_Q62878", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193993", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-194002", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-194002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_058961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "67377", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=67377", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "14709", "url": "https://www.rhea-db.org/rhea/14709", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "24076", "url": "https://www.rhea-db.org/rhea/24076", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q62878-1", "url": "https://www.uniprot.org/uniprot/Q62878-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLEGDILDTQCLRRACQGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAFIYCSTVDVAGPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERSPFLSVMILAALKSKGILNVTGKFSIANPVYVGNVAWAHILAARGLRDPKKSQNVQGQFYYISDDTPHQSYDDLNYTLSKEWGLHLDSSWSLPLPLLYWLAFLLEIVSFFLHPVYNYRPSFNRHLVTLSNSKFTFSYKKAQRDLGYKPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|Q62878-1|3BHS4_RAT Isoform 1 of 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus OX=10116 GN=Hsd3b6 PE=2 SV=4 CANONICAL=Q62878-1" }, "isoforms": [ { "isoform_ac": "Q62878-1", "url": "", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLEGDILDTQCLRRACQGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAFIYCSTVDVAGPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERSPFLSVMILAALKSKGILNVTGKFSIANPVYVGNVAWAHILAARGLRDPKKSQNVQGQFYYISDDTPHQSYDDLNYTLSKEWGLHLDSSWSLPLPLLYWLAFLLEIVSFFLHPVYNYRPSFNRHLVTLSNSKFTFSYKKAQRDLGYKPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|Q62878-1|3BHS4_RAT Isoform 1 of 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus OX=10116 GN=Hsd3b6 PE=2 SV=4 CANONICAL=Q62878-1" }, "locus": { "chromosome": "2", "start_pos": 186101770, "end_pos": 186096228, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000026306", "url": "https://www.ensembl.org/id/ENSRNOT00000026306" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000026306", "url": "https://www.ensembl.org/id/ENSRNOP00000026306" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Expression of androgen receptor and 3beta-hydroxysteroid dehydrogenase in corpora lutea during pregnancy in the rat.", "journal": "Reproduction, fertility, and development", "date": "2007", "authors": "Szoltys M, Slomczynska M, Galas J, Duda M, Sakiewicz A", "evidence": [ { "database": "RefSeq", "id": "NP_058961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961" } ], "reference": [ { "type": "PubMed", "id": "17257522", "url": "https://glygen.org/publication/PubMed/17257522" } ] }, { "title": "Studies on the protective role of lycopene against polychlorinated biphenyls (Aroclor 1254)-induced changes in StAR protein and cytochrome P450 scc enzyme expression on Leydig cells of adult rats.", "journal": "Reproductive toxicology (Elmsford, N.Y.)", "date": "2009", "authors": "Elumalai P, Krishnamoorthy G, Selvakumar K, Arunkumar R, Venkataraman P, Arunakaran J", "evidence": [ { "database": "RefSeq", "id": "NP_058961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058961" } ], "reference": [ { "type": "PubMed", "id": "19071209", "url": "https://glygen.org/publication/PubMed/19071209" } ] }, { "title": "Structure and tissue-specific expression of a novel member of the rat 3 beta-hydroxysteroid dehydrogenase/delta 5-delta 4 isomerase (3 beta-HSD) family. The exclusive 3 beta-HSD gene expression in the skin.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Simard J, Couet J, Durocher F, Labrie Y, Sanchez R, Breton N, Turgeon C, Labrie F", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "reference": [ { "type": "PubMed", "id": "7690038", "url": "https://glygen.org/publication/PubMed/7690038" } ] } ], "pathway": [ { "id": "rno:29632", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:29632", "resource": "KEGG Pathway" }, { "id": "R-RNO-193048", "name": "Androgen biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193048", "resource": "Reactome", "description": "Androgen biosynthesis" }, { "id": "R-RNO-193993", "name": "Mineralocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193993", "resource": "Reactome", "description": "Mineralocorticoid biosynthesis" }, { "id": "R-RNO-194002", "name": "Glucocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-194002", "resource": "Reactome", "description": "Glucocorticoid biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "O35469-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6", "gene_name": "Hsd3b6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLMQEKDLEEIRVLDKFFRPETREQFFNLDTNIKVTVLEGDILDTQYLRKACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIILNGNEEEHHESIWSDPYPYSKKMAEKAVLAANGSMLKIGGTLHTCALRPMYIYGERSPFISNTIITALKNKNILGCTGKFSTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCPDSSWSLPVPLLYWLAFMLETVSFLLSPIYRFIPPFNRHLVTLTGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373 }, "evidence": [ { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P14060-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1", "gene_name": "HSD3B1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 373 }, "evidence": [ { "id": "45227315", "url": "http://www.informatics.jax.org/homology/45227315", "database": "MGI" }, { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" }, { "id": "45227313", "url": "http://www.informatics.jax.org/homology/45227313", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P26149-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2", "gene_name": "Hsd3b2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEGDILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETVSFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373 }, "evidence": [ { "id": "45227313", "url": "http://www.informatics.jax.org/homology/45227313", "database": "MGI" }, { "id": "Q62878", "url": "https://omabrowser.org/oma/group/Q62878/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P26150-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3", "gene_name": "Hsd3b3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIIQLLVQEKDLEEIRVLDKVFKPETREQFFNLGTSIKVTVLEGDILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKDIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCALRPMCIYGERSQFLSNTIIKALKNKFILRGGGKFSTANPVYVGNVAWAHILAARGLRNPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCLNSRWYLPVPILYWLAFLLETVSFLLSPIYRYIPPFNRHLVTLTASTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373 }, "evidence": [ { "id": "45227315", "url": "http://www.informatics.jax.org/homology/45227315", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P26439-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2", "gene_name": "HSD3B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 372 }, "evidence": [ { "id": "45227315", "url": "http://www.informatics.jax.org/homology/45227315", "database": "MGI" }, { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" }, { "id": "45227313", "url": "http://www.informatics.jax.org/homology/45227313", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "response to lead ion", "id": "GO:0010288", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010288", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "hippocampus development", "id": "GO:0021766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "response to cadmium ion", "id": "GO:0046686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046686", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "C21-steroid hormone biosynthetic process", "id": "GO:0006700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006700", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "steroid biosynthetic process", "id": "GO:0006694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006694", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "androgen biosynthetic process", "id": "GO:0006702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006702", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "C21-steroid hormone metabolic process", "id": "GO:0008207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008207", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "Leydig cell differentiation", "id": "GO:0033327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033327", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "response to gonadotropin", "id": "GO:0034698", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034698", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "negative regulation of iron ion transport", "id": "GO:0034757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034757", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "3-beta-hydroxy-delta5-steroid dehydrogenase activity", "id": "GO:0003854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003854", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "steroid delta-isomerase activity", "id": "GO:0004769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004769", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "cholesterol dehydrogenase activity", "id": "GO:0102294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102294", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "isomerase activity", "id": "GO:0016853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016853", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" }, { "name": "testosterone dehydrogenase [NAD(P)] activity", "id": "GO:0030283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030283", "evidence": [ { "database": "UniProtKB", "id": "Q62878", "url": "https://www.uniprot.org/uniprot/Q62878" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 213, "end_pos": 215, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14709", "name": "", "equation": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22072-1", "P22071-1", "Q62878-1", "P14060-1", "P26439-1", "O35469-1", "P24815-1", "P26149-1", "P26150-1" ], "evidence": [ { "id": "14709", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14709" } ] }, { "id": "24076", "name": "", "equation": "a 3beta-hydroxy-Delta(5)-steroid + NAD(+) = a 3-oxo-Delta(5)-steroid + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22072-1", "P22071-1", "Q62878-1", "Q9H2F3-1", "P14060-1", "P26439-1", "O35469-1", "P26150-1", "P24815-1", "P26149-1", "Q9EQC1-1" ], "evidence": [ { "id": "24076", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24076" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O35469", "gene_name": "Hsd3b6", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] }, { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] } ] }, { "uniprot_ac": "P14060", "gene_name": "HSD3B1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] } ] }, { "uniprot_ac": "P22071", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] } ] }, { "uniprot_ac": "P22072", "gene_name": "Hsd3b", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22072" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22072" } ] } ] }, { "uniprot_ac": "P24815", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] } ] }, { "uniprot_ac": "P26149", "gene_name": "Hsd3b2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] } ] }, { "uniprot_ac": "P26150", "gene_name": "Hsd3b3", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26150" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26150" } ] } ] }, { "uniprot_ac": "P26439", "gene_name": "HSD3B2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] } ] }, { "uniprot_ac": "Q62878", "gene_name": "Hsd3b6", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "Q62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62878" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "Q62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62878" } ] } ] }, { "uniprot_ac": "Q9EQC1", "gene_name": "Hsd3b7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9EQC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC1" } ] }, { "ec_number": "1.1.1.181", "activity": "7alpha-hydroxycholesterol + NAD(+) = 7alpha-hydroxycholest-4-en-3-one + H(+) + NADH.", "evidence": [ { "id": "Q9EQC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC1" } ] } ] }, { "uniprot_ac": "Q9H2F3", "gene_name": "HSD3B7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9H2F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2F3" } ] }, { "ec_number": "1.1.1.181", "activity": "7alpha-hydroxycholesterol + NAD(+) = 7alpha-hydroxycholest-4-en-3-one + H(+) + NADH.", "evidence": [ { "id": "Q9H2F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2F3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }