{ "uniprot_canonical_ac": "Q61168-1", "uniprot_ac": "Q61168", "uniprot_id": "LAPM5_MOUSE", "mass": { "chemical_mass": 29602.0, "monoisotopic_mass": 29602.0 }, "refseq": { "ac": "NP_034816", "name": "lysosomal-associated transmembrane protein 5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816" }, "gene_names": [ { "name": "Laptm5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q61168", "id": "Q61168" }, { "name": "E3; Stra13", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816", "id": "NP_034816" }, { "name": "Laptm5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816", "id": "NP_034816" } ], "protein_names": [ { "name": "Lysosomal-associated transmembrane protein 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q61168" }, { "name": "Lysosomal-associated multitransmembrane protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61168" }, { "name": "Retinoic acid-inducible E3 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61168" }, { "name": "lysosomal-associated transmembrane protein 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816", "id": "NP_034816" }, { "name": "retinoic acid-inducible E3 protein; lysosomal-associated multitransmembrane protein 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816", "id": "NP_034816" } ], "function": [ { "annotation": "Lysosomal-associated protein transmembrane 5 ameliorates non-alcoholic steatohepatitis by promoting the degradation of CDC42 in mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_034816", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816" }, { "database": "PubMed", "id": "37156795", "url": "https://glygen.org/publication/PubMed/37156795" } ] }, { "annotation": "May have a special functional role during embryogenesis and in adult hematopoietic cells.", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168#function" }, { "database": "PubMed", "id": "8661146", "url": "https://glygen.org/publication/PubMed/8661146" } ] }, { "annotation": "Suppression of lysosomal-associated protein transmembrane 5 ameliorates cardiac function and inflammatory response by inhibiting the nuclear factor-kappa B (NF-kappaB) pathway after myocardial infarction in mice.", "evidence": [ { "database": "RefSeq", "id": "NP_034816", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816" }, { "database": "PubMed", "id": "35491099", "url": "https://glygen.org/publication/PubMed/35491099" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Laptm5", "url": "https://www.uniprot.org/uniprot/Q61168", "locus": { "chromosome": "4", "start_pos": 130663452, "end_pos": 130640436, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028581", "url": "https://www.ensembl.org/id/ENSMUSG00000028581" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028581", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028581", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "16792", "url": "https://www.ncbi.nlm.nih.gov/gene/16792", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q61168", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q61168*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004687", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004687", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:16792", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16792", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "108046", "url": "http://www.informatics.jax.org/marker/MGI:108046", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QICCCFN", "url": "https://omabrowser.org/oma/group/QICCCFN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5322047at2759", "url": "http://www.orthodb.org/?query=5322047at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12479", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12479", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12479:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12479:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03821", "url": "http://pfam.xfam.org/family/PF03821", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q61168", "url": "http://purl.obolibrary.org/obo/PR_Q61168", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_034816", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B1ASF7", "url": "https://www.uniprot.org/uniprot/B1ASF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1ASF7-1", "url": "https://www.uniprot.org/uniprot/B1ASF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6WX18", "url": "https://www.uniprot.org/uniprot/F6WX18", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6WX18-1", "url": "https://www.uniprot.org/uniprot/F6WX18-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WH95", "url": "https://www.uniprot.org/uniprot/F8WH95", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WH95-1", "url": "https://www.uniprot.org/uniprot/F8WH95-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q61168-1", "url": "https://www.uniprot.org/uniprot/Q61168-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEEALSLPPKTPEGDPAPPPYSEV", "length": 261, "header": "sp|Q61168-1|LAPM5_MOUSE Isoform 1 of Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1 CANONICAL=Q61168-1" }, "isoforms": [ { "isoform_ac": "B1ASF7-1", "url": "", "sequence": { "sequence": "MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMALPQSLPCLAADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLS", "length": 107, "header": "tr|B1ASF7-1|LAPM5_MOUSE Computationally mapped isoform of Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1 CANONICAL=Q61168-1" }, "locus": { "chromosome": "4", "start_pos": 130655980, "end_pos": 130640659, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000156225.8", "url": "https://www.ensembl.org/id/ENSMUST00000156225.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121133.2", "url": "https://www.ensembl.org/id/ENSMUSP00000121133.2" } ] } }, { "isoform_ac": "F6WX18-1", "url": "", "sequence": { "sequence": "XAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKRCAQSTVNPVAE", "length": 241, "header": "tr|F6WX18-1|F6WX18_MOUSE Computationally mapped isoform of Lysosomal-associated protein transmembrane 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1 CANONICAL=Q61168-1" }, "locus": { "chromosome": "4", "start_pos": 130660977, "end_pos": 130640669, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000156742.8", "url": "https://www.ensembl.org/id/ENSMUST00000156742.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123382.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123382.2" } ] } }, { "isoform_ac": "F8WH95-1", "url": "", "sequence": { "sequence": "XGGLNWAIDDRDGATLCGTVGCSYRKILPGQRVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEEALSLPPKTPEGDPAPPPYSEV", "length": 264, "header": "tr|F8WH95-1|LAPM5_MOUSE Computationally mapped isoform of Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1 CANONICAL=Q61168-1" }, "locus": { "chromosome": "4", "start_pos": 130661859, "end_pos": 130643260, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000030316.7", "url": "https://www.ensembl.org/id/ENSMUST00000030316.7" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000030316.7", "url": "https://www.ensembl.org/id/ENSMUSP00000030316.7" } ] } }, { "isoform_ac": "Q61168-1", "url": "", "sequence": { "sequence": "MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEEALSLPPKTPEGDPAPPPYSEV", "length": 261, "header": "sp|Q61168-1|LAPM5_MOUSE Isoform 1 of Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1 CANONICAL=Q61168-1" }, "locus": { "chromosome": "4", "start_pos": 130661858, "end_pos": 130640659, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000151698", "url": "https://www.ensembl.org/id/ENSMUST00000151698" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118415", "url": "https://www.ensembl.org/id/ENSMUSP00000118415" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 258, "end_pos": 258, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" }, { "database": "PubMed", "id": "17947660", "url": "https://glygen.org/publication/PubMed/17947660" }, { "database": "iPTMnet", "id": "Q61168", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q61168" } ], "site_lbl": "Tyr258" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Cao L, Yu K, Banh C, Nguyen V, Ritz A, Raphael BJ, Kawakami Y, Kawakami T, Salomon AR", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" }, { "database": "UniProtKB", "id": "F8WH95", "url": "https://www.uniprot.org/uniprot/F8WH95" }, { "database": "iPTMnet", "id": "Q61168", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q61168" } ], "reference": [ { "type": "PubMed", "id": "17947660", "url": "https://glygen.org/publication/PubMed/17947660" } ] }, { "title": "Suppression of lysosomal-associated protein transmembrane 5 ameliorates cardiac function and inflammatory response by inhibiting the nuclear factor-kappa B (NF-\u03baB) pathway after myocardial infarction in mice.", "journal": "Experimental animals", "date": "2022-11-10", "authors": "Song Zhanchun, Wang Xiaozeng, He Lianqi, Chen Liang, Ren Zhichao, Song Siyu", "evidence": [ { "database": "RefSeq", "id": "NP_034816", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816" } ], "reference": [ { "type": "PubMed", "id": "35491099", "url": "https://glygen.org/publication/PubMed/35491099" } ] }, { "title": "Lysosomal-associated protein transmembrane 5 ameliorates non-alcoholic steatohepatitis by promoting the degradation of CDC42 in mice.", "journal": "Nature communications", "date": "2023-05-08", "authors": "Jiang Lang, Zhao Jing, Yang Qin, Li Mei, Liu Hao, Xiao Xiaoyue, Tian Song, Hu Sha, Liu Zhen, Yang Peiwen, Chen Manhua, Ye Ping, Xia Jiahong", "evidence": [ { "database": "RefSeq", "id": "NP_034816", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034816" } ], "reference": [ { "type": "PubMed", "id": "37156795", "url": "https://glygen.org/publication/PubMed/37156795" } ] }, { "title": "LAPTM5: a novel lysosomal-associated multispanning membrane protein preferentially expressed in hematopoietic cells.", "journal": "Genomics", "date": "1996", "authors": "Kobayashi H., Zhu S., Lim B., Rowley J.D., Horiuchi T., Adra C.N., Guillemot J.-C., Lelias J.-M., Cuervo A.M., Ko J.-L.", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "reference": [ { "type": "PubMed", "id": "8661146", "url": "https://glygen.org/publication/PubMed/8661146" } ] }, { "title": "E3, a hematopoietic-specific transcript directly regulated by the retinoic acid receptor alpha.", "journal": "Blood", "date": "1996", "authors": "Scott LM, Mueller L, Collins SJ", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "reference": [ { "type": "PubMed", "id": "8839844", "url": "https://glygen.org/publication/PubMed/8839844" } ] } ], "pathway": [ { "id": "mmu:16792", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:16792", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q13571-1", "protein_name": "Lysosomal-associated transmembrane protein 5", "gene_name": "LAPTM5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV", "length": 262 }, "evidence": [ { "id": "45241877", "url": "http://www.informatics.jax.org/homology/45241877", "database": "MGI" }, { "id": "Q61168", "url": "https://omabrowser.org/oma/group/Q61168/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6P9Z7-1", "protein_name": "Lysosomal protein transmembrane 5", "gene_name": "Laptm5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASRAVPVRQTCCCFNVRVATVALAIYHIVMSVLLFIEHVVEVARGKVSCRFSKMPYLRLADLLSSFLLIGVLFIISLSLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKFARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGMPRSQFINMMLIFSVAFITVLILKVYMFKCVWTCYRFMKHMNSAVEDSSSKLFLKVALPSYEEALSLPTKTPEGDLAPPPYSEV", "length": 261 }, "evidence": [ { "id": "45241877", "url": "http://www.informatics.jax.org/homology/45241877", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ubiquitin-dependent protein binding", "id": "GO:0140036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140036", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "protein sequestering activity", "id": "GO:0140311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140311", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 28, "go_terms": [ { "name": "positive regulation of lysosomal membrane permeability", "id": "GO:0097214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097214", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of autophagic cell death", "id": "GO:1904093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904093", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "defense response to tumor cell", "id": "GO:0002357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002357", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "induction of programmed cell death", "id": "GO:0012502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012502", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of receptor catabolic process", "id": "GO:2000646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000646", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of interleukin-2 production", "id": "GO:0032703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032703", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of NIK/NF-kappaB signaling", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "protein targeting to lysosome", "id": "GO:0006622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006622", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "Golgi to lysosome transport", "id": "GO:0090160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090160", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of proteolysis involved in protein catabolic process", "id": "GO:1903052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903052", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of activated T cell proliferation", "id": "GO:0046007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046007", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor-mediated signaling pathway", "id": "GO:1903265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903265", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of macrophage cytokine production", "id": "GO:0060907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060907", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of T cell receptor signaling pathway", "id": "GO:0050860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050860", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of T cell activation", "id": "GO:0050868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050868", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in immune response", "id": "GO:0002720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002720", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of B cell activation", "id": "GO:0050869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050869", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of ubiquitin-dependent protein catabolic process", "id": "GO:2000060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000060", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "protein localization to lysosome", "id": "GO:0061462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061462", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "negative regulation of pre-B cell receptor expression", "id": "GO:0140646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140646", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "transport vesicle", "id": "GO:0030133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030133", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "Q61168", "url": "https://www.uniprot.org/uniprot/Q61168" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }